Gallus gallus (chicken): 378804 Help Entry 378804            CDS       T01006                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism gga  Gallus gallus (chicken) Pathway gga04010   MAPK signaling pathway gga04020   Calcium signaling pathway gga04114   Oocyte meiosis gga04218   Cellular senescence gga04310   Wnt signaling pathway gga04370   VEGF signaling pathway gga04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:gga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     378804 (PPP3R1)    04310 Wnt signaling pathway     378804 (PPP3R1)    04370 VEGF signaling pathway     378804 (PPP3R1)    04020 Calcium signaling pathway     378804 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     378804 (PPP3R1)    04218 Cellular senescence     378804 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     378804 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gga01009]     378804 (PPP3R1) Protein phosphatases and associated proteins [BR:gga01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      378804 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  378804 NCBI-ProteinID:  NP_989707 CGNC:  49127 Ensembl:  ENSGALG00000023648 UniProt:  Q6VN51 LinkDB All DBs Position 3:complement(11868416..11901866) Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagctaccctttggaaatgtgctcgcactttgatgctgatgagatt aaacggctaggaaagagatttaagaagcttgatttggacaactctggttctttgagcgtg gaagagttcatgtctttacctgaattgcaacagaacccgttggtacagcgagtaatagat atatttgacacagacggcaatggagaagtggacttcaaagaatttatagaaggagtctcc cagttcagtgtcaaaggagataaggaacagaagttgaggtttgcttttcgcatctacgac atggacaaagatggttatatctcaaatggcgagctcttccaggtgctgaagatgatggtg gggaacaatctcaaagacactcagttacagcaaattgtagataaaaccataattaatgca gataaggatggtgatggaagaatatcctttgaagaattctgtgctgttgtaggaggccta gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system