KEGG   Gallus gallus (chicken): 395719Help
Entry
395719            CDS       T01006                                 

Gene name
TK1, TK
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00240  Pyrimidine metabolism
gga00983  Drug metabolism - other enzymes
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    395719 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    395719 (TK1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     395719 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK ATPase_2 AAA_14 RecA
Motif
Other DBs
NCBI-GeneID: 395719
NCBI-ProteinID: NP_990229
CGNC: 5434
Ensembl: ENSGALG00000007191
UniProt: P04047
LinkDB All DBs
Position
18
AA seq 224 aa AA seqDB search
MNCLTVPGVHPGSPGRPRGQIQVIFGPMFSGKSTELMRRVRRFQLAQYRCLLVKYAKDTR
YCTTGVSTHDRNTMEARPACALQDVYQEALGSAVIGIDEGQFFPDIVEFCEKMANTGKTV
IVAALDGTFQRKAFGSILNLVPLAESVVKLNAVCMECYREASYTKRLGAEREVEVIGGAD
KYHSVCRACYFQKRPQQLGSENKENVPMGVKQLDMPASRKIFAS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtctgaccgtgcccggtgtgcaccccggctcgcccggccgcccgcgtgggcag
atccaggtgatcttcggccccatgttctctgggaagagcactgagctcatgcggcgggtg
cggcgcttccagctcgctcagtaccggtgtctgctggtgaagtacgccaaggacacgcgc
tactgcaccaccggcgtctccacacatgacaggaacaccatggaggcccgccctgcctgt
gcccttcaggatgtgtaccaggaggcgctgggctctgcggtcattggcattgacgagggg
cagtttttcccagatattgtggagttttgtgaaaagatggccaacactgggaaaaccgtc
atcgttgctgctcttgatgggactttccaaagaaaggcttttgggagcatcctcaacctg
gtccctctggctgagagcgtggtgaagctgaacgctgtctgcatggagtgctaccgagag
gcctcctacacaaagaggctgggagcagagagggaggttgaagtgattggaggagcagac
aaataccactctgtctgccgagcttgctacttccagaagaggcctcagcagcttgggtca
gaaaacaaggagaatgtgcccatgggggtgaagcagctggatatgccagcctcacgaaag
atctttgcttcttga

DBGET integrated database retrieval system