KEGG   Gallus gallus (chicken): 395743Help
Entry
395743            CDS       T01006                                 

Gene name
GAD1, GAD67
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
gga  Gallus gallus (chicken)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    395743 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    395743 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    395743 (GAD1)
   00430 Taurine and hypotaurine metabolism
    395743 (GAD1)
Enzymes [BR:gga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     395743 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 590 aa AA seqDB search
MASSAPSSSNDAPDPAPTNLRPTTYDSWCGVAHGCTRKIGLKICGFLQRTNSLEDKGRIV
GSLKERQSSKNLLACENSEREARFRRTETDFSNLYARDLLPAKNGEEQTMQFLLEVVDIL
LNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDMIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFG
TDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLFVNATAGTTVYGAFDPIQEIADICE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVREKGIL
QGCNQMCAGYLFQQDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCL
ELAEYLYTKIKNREEFEMVFEGEPEHTNVCFWYIPPSLRGMPDCDERREKLHRVAPKIKA
LMMESGTTMVGYQPQGDKVNFFRMVISNPAATKSDIDFLIEEIERLGQEL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccgctccctcgtcctccaacgacgctccggaccccgccccgaccaattta
cgacccacaacctacgactcgtggtgcggcgtggcgcacggatgcaccaggaagatcggc
ctgaagatatgcgggttcctgcagaggaccaacagcctggaagacaaaggccggatcgtg
ggctccctgaaggagcggcagtcctccaagaacctgctggcgtgcgagaacagcgagcgg
gaagcccggttccgccgcaccgagacagacttctccaacctgtatgcccgagatttgctg
cccgctaagaatggcgaggagcagactatgcagttcctgctggaggtcgtggacatactc
ctcaactacgtgaggaagacgtttgacagatccaccaaagtgctggacttccaccacccg
caccagctgctggagggcatggagggcttcaacctggagctgtcggacaaccccgagtcc
ctggagcagattctggtggactgccgggacacgctcaagtacggggtgcggacaggtcac
ccgcgcttcttcaatcagctgtccacggggctggacatgatcggcctggcgggggagtgg
ctgacatccaccgctaacaccaacatgtttacgtatgaaattgcccctgtttttgtcctc
atggaacaaataacacttcgaaagatgagagagattattggatggtcgaataaagatggc
gatggaatattctcacctggaggagccatctccaacatgtacagcataatggccgcacgc
tacaaatatttccccgaagtcaaaaccaaaggcatggctgcagtccctaaactggttctc
tttacctcagaacatagtcactactcaataaagaaagctggagctgcacttggatttgga
acagacaatgtaattttgataaagtgcaacgaaagaggcaaaataataccagctgattta
gaagcaaaaattttggaagcaaaacagaagggatacgttcctctctttgtaaacgcaact
gcgggcacaacagtttatggagcctttgatccaatacaggagattgcagatatatgtgaa
aaatacaacctttggcttcatgtagatgctgcctggggaggtgggctcttgatgtcccga
aagcatcgtcataaactgaatggaatagaaagagccaattcagtcacttggaatccacac
aagatgatgggagtattgttgcagtgttctgccattctggtccgggagaagggaatactt
caaggctgcaatcaaatgtgtgcaggatatcttttccagcaagacaaacagtacgatgta
tcctatgacactggagataaggcaatacagtgtggtcgacatgtggacattttcaaattc
tggttgatgtggaaggcaaagggtacagtgggatttgaaaatcagatcaacaaatgcctg
gaactggcagaatatctctataccaaaataaaaaacagagaagaatttgagatggttttt
gaaggagagccggagcacacaaatgtatgcttttggtatattccaccaagtctcagaggc
atgccagactgtgatgagagacgagaaaagctgcacagggtggcaccgaaaatcaaagcc
ctgatgatggagtcaggtactaccatggttggatatcagcctcagggcgataaagtcaac
ttcttccgaatggtcatctcaaacccagcagcaactaagtctgacatagacttcctcatt
gaggaaatagagagattggggcaggagctgtag

DBGET integrated database retrieval system