KEGG   Gallus gallus (chicken): 396432Help
Entry
396432            CDS       T01006                                 

Gene name
TGM2, TGL2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     396432 (TGM2)
Cell adhesion molecules and their ligands [BR:gga04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     396432 (TGM2)
   VLA-5
     396432 (TGM2)
   VLA-9
     396432 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
32
AA seq 698 aa AA seqDB search
MGGPGPDGTMAEELVLETCDLQCERNGREHRTEEMGSQQLVVRRGQPFTITLNFAGRGYE
EGVDKLAFDVETGPCPVETSGTRSHFTLTDCPEEGTWSAVLQQQDGATLCVSLCSPSIAR
VGRYRLTLEASTGYQGSSFHLGDFVLLFNAWHPEDAVYLKEEDERREYVLSQQGLIYMGS
RDYITSTPWNFGQFEDEILAICLEMLDINPKFLRDQNLDCSRRNDPVYIGRVVSAMVNCN
DEDHGVLLGRWDNHYEDGMSPMAWIGSVDILKRWRRLGCQPVKYGQCWVFAAVACTVMRC
LGVPSRVVTNYNSAHDTNGNLVIDRYLSETGMEERRSTDMIWNFHCWVECWMTRPDLAPG
YDGWQALDPTPQEKSEGVYCCGPAPVKAIKEGDLQVQYDIPFVFAEVNADVVYWIVQSDG
EKKKSTHSSVVGKNISTKSVGRDSREDITHTYKYPEGSEKEREVFSKAEHEKSSLGEQEE
GLHMRIKLSEGANNGSDFDVFAFISNDTDKERECRLRLCARTASYNGEVGPQCGFKDLLN
LSLQPHMEQSVPLRILYEQYGPNLTQDNMIKVVALLTEYETGDSVVAIRDVYIQNPEIKI
RILGEPMQERKLVAEIRLVNPLAEPLNNCIFVVEGAGLTEGQRIEELEDPVEPQAEAKFR
MEFVPRQAGLHKLMVDFESDKLTGVKGYRNVIIAPLPK
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaccgggaccggacgggaccatggccgaagagctggtgctggagacgtgcgac
ctgcagtgcgagcgcaatggccgcgagcaccggacggaggagatgggcagccagcagctg
gtggtgcggcgcgggcagcccttcaccatcaccctgaacttcgccggacggggctacgag
gagggggtggacaaactcgccttcgacgtggagacggggccctgtcccgttgagacgtca
ggcaccaggtcgcacttcaccttgaccgactgccccgaggaggggacctggagtgcagtg
ttgcagcagcaggatggggccacgctctgtgtatcgctctgctcccccagcattgcccgc
gtgggccgctaccgcctgacgctggaggcctccacggggtaccagggctccagcttccac
ctcggggacttcgttctgctcttcaatgcctggcacccagaggatgcagtgtacctgaag
gaagaggacgagcgccgtgagtacgtgctgtcccagcaggggctcatctacatgggctcc
agggactacataacctccacaccctggaactttgggcagtttgaagatgagatcttggcc
atctgcctcgagatgctggacatcaaccccaaattcctgcgggaccagaacctggactgc
tcccgtcgcaatgaccctgtttatattggcagggtggtgagcgccatggtcaactgcaat
gacgaggaccacggggtgctgctggggcgctgggacaatcactatgaggatgggatgagc
ccaatggcatggatcggcagcgtggacatcctcaagaggtggaggaggttgggctgccag
cctgtcaagtacggccagtgctgggtcttcgctgccgtggcgtgcactgtcatgcgctgc
ctgggcgtccccagccgtgtggtcaccaactacaactctgcccacgacaccaacggcaac
ctggtgatcgaccgctacctgagcgagacgggcatggaggagcggcgctccacggacatg
atctggaacttccactgctgggtggagtgctggatgacccggcctgacctggcacctgga
tacgatgggtggcaagcgctggaccccacgccccaggagaagagcgaaggggtttactgc
tgcgggccggcccctgtcaaggccatcaaggagggcgacctgcaggtgcagtacgacatc
cccttcgtctttgcggaggtcaatgctgacgtggtgtactggatcgttcagagtgacggt
gagaagaagaagagcacccactcctcagtggtggggaagaacatcagcaccaagagcgtc
ggcagggacagccgcgaggacatcacccacacctacaagtatccggaggggtctgagaag
gagcgagaggtgttcagcaaggcggagcacgagaagagctcgctgggtgagcaggaagag
gggctccacatgcggatcaagctgtcggagggtgccaacaacggctccgacttcgacgtc
ttcgctttcatcagcaacgacacggacaaggagcgtgagtgcaggctgaggctgtgcgcc
cgcaccgccagctacaacggcgaggtgggcccgcagtgcggcttcaaggacctgctgaac
ctcagcctccagccccacatggaacagagcgtgcccttgcgcatcctctatgagcagtac
gggcccaacctgacccaggacaacatgatcaaggtggtggctctgctgactgagtatgag
actggtgacagcgtggtggccatcagggatgtctacatccagaacccagagatcaagatc
aggattttaggggagccaatgcaggagcggaagctggtggcagagatcagactggtgaac
ccactggcagagccactgaacaactgcatattcgtggtggaaggcgccggcctcactgag
gggcagaggatcgaggagcttgaggatcctgtggagccgcaagcagaggccaagttccgg
atggagttcgtgccgcgccaggcagggctgcacaagctgatggtggactttgagagcgac
aagctgacgggagtgaagggctaccgcaacgtcatcatcgcacccctgcccaagtga

DBGET integrated database retrieval system