Geobacillus sp. GHH01: GHH_c32150 Help Entry GHH_c32150        CDS       T02455                                  Symbol flgM Name (GenBank) anti-sigma-28 factor   KO K02398   negative regulator of flagellin synthesis FlgM Organism ggh  Geobacillus sp. GHH01 Pathway ggh02020   Two-component system ggh02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ggh00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     GHH_c32150 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     GHH_c32150 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ggh02035]     GHH_c32150 (flgM) Bacterial motility proteins [BR:ggh02035]  Flagellar system   Flagellar assembly proteins    Others     GHH_c32150 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AGE23706 UniProt:  L8A3U6 LinkDB All DBs Position complement(3196101..3196367) Genome browser AA seq 88 aa AA seqDB search MKIHHIGSMNVNPYQRQLVKTERLAAGKANGDQVEISKEAKELQEAASWEQARQAKLEEL RQQIETGAYEVDPRAVAKRMIEYYRNHR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaaaatccaccatatcggttcaatgaacgtcaacccgtatcaacgccagctcgtcaaa acagagcggctggcggcggggaaagccaatggcgatcaagtggaaatttccaaagaagcg aaagagctgcaagaagcggcaagctgggaacaggcgcggcaagcgaaacttgaagagctg cgccaacaaattgaaaccggcgcatacgaagtcgacccgcgggcggtcgccaagcggatg atcgagtattaccgaaaccatcgataa

DBGET integrated database retrieval system