KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101132140Help
Entry
101132140         CDS       T02442                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101132140 (SETD2)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101132140 (SETD2)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101132140 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 2564 aa AA seqDB search
MKQLQPQPPPKMGDFYDPEHPTPEEEENEAKIENVQKTGFIKGPMFKGVASSRFLPKGTK
TKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQSDTPNPPAVPLQVDSTPKMKMEI
GDTLSTAEESSPPKSRVELGKIHFKKHLLHVTSRPLLATTTAVASPPTHAAPLPAVIAES
TTVDSPPSSPPPPPPPAQATTLSSPAPVTEPVALPHTPITVLMAAPVPLPVDVAVRSLKE
PPIIIVPESLEADTKQDTVSNSSEEHITQILNEQADISSKKEDSHIGKDEEIPDSSKISL
SCKKTGSKKKPSQSEGIFLGSESDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKS
EDLGKSSRSKTDRDDKYFSYSKLERDTRYVSSRCRSERERRRSRSHSRSERGSRTNLSYS
RSERSHYYDSDRRYHRSSPYRERTRYSRPYTDNRARESSDSEEEYKKTYSRRTSSHSSSY
RDLRTSSYSKSDRDCKTETSYLEMERRGKYSSKLERESKRTSENEAIKRCCSPPNELGFR
RGSSYSKHDSSASRYKSTLSKPIPKSDKFKNSFCCTELNEEIKQSHSFSLQTPCSKGSEL
RMINKNPEREKAGSPAPSNRLNDSPTLKKLDELPIFKSEFITHDSHDSIKELDSLSKVKN
DQLRSFCPIELNINGSPGAESDLATFCTSKTDAVLMTSDDSVTGSELSPLVKACMLSSNG
FQNISRCKEKDLDDTCMLHKKSESPFRETEPLVSPHQDKLMSLPVMTVDYSKTVVKEPVD
TRVSCCKTKDSEIYCTSNDSNPSLCNSEAENTELSVMKISSNSFMNVHLESKPVICDSRN
LTDHSKFACEEYKQSIGSTSSASVNHFDDLYQPIGSSGIASSLQSLPPGIKVDSLTLLKC
GENTSPVLDAVLKSKKSSEFLKHAGKETIVEVGSDLPDSGKGFASRENRRNNGLSGKCLQ
EAQEEGNSILPERRGRPEISLDERGEGGHVHTSDDSEVVFSSCDLNLTMEDSDGVTYALK
CDSSGHAPEIVSTVHEDYSGSSESSNDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLPM
EETSPCSSRSSQSYRHYSDHWEDERLESRRHLYEEKFENIASKACPQTDKFFLHKGTEKN
PEISFTQSSRKQIDNHLPELSHPQSDGVDSTSHTDVKSDPLGHPNSEETVKAKIPSRQQE
ELPIYSSDFEDIPNKSWQQTTFQNRPDSRLGKTELSFSSSCEIPHVDGLHSSEELRNLGW
DFSQEKPSTTYQQPDSSYGACGGHKYQQNAEQYGGTHDYWQGNGYWDPRSGRPPGTGVVY
DRTQGQVPDSLTDDREEEENWDQRDGSHFSDQSNKFLLSLQKDKGSVQAPEISSNSIKDT
LAVNEKKDFSKNLEKNDIKDRGPLKKRRQEIESDSESDGELQDRKKVRVEVEQGETSVPP
GSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCE
CTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKK
GWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQK
GNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFC
GSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSR
LMVRIETLEQKLTCLELIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEI
IKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAVPPLSEGDGYSSENTSRAHTPLNTPDP
STKLSTETDTDTPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPVEEE
EELQSQQLLPQQLPECKVDSETNIEASKLPTSEPEADAEIEPKESNDTKLEEPINEETPS
QDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENTTTER
GRDAVGLRDQTPAPKTPNRSRERDPDKQTQNKEKRKRRSSLSPPSSAYERGTKRPDDRYD
TPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAP
HHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAP
PPVPVVPHVAAPVEVSSSQYVAQSDGVVHQDSSVAVLPVPAPGPVQGQNYSVWDSNQQSV
SVQQQYSPAQSQATIYYQGQTCPTVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAH
PQGVVVQPAAAVTTIVAPGQPQPLQPSEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARD
PEGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKASKKPKTAEA
DTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKE
LKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7695 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgcagccgcagccgcctccgaagatgggggatttctacgacccggagcac
ccgacccctgaagaagaagaaaatgaggcaaagattgaaaatgtgcagaaaacaggtttc
atcaaaggaccaatgttcaaaggtgttgcttctagtcgatttttgcccaaaggcaccaaa
acaaaagttaatttggaagaacagggacgacagaaggtgtcattcagcttcagccttaca
aagaaaactttgcagaataggtttctcactgcacttggcaatgaaaagcaaagtgatact
ccaaaccctccagctgtacctcttcaggtagactcgactcctaaaatgaaaatggaaatt
ggtgataccttatctactgcagaagaatcttccccaccaaagtcaagggtggaattgggc
aaaattcattttaagaaacatctgcttcatgtaacatccaggccactgctggctactacc
acagcagtagcatctccacctactcatgcagcaccattaccagcagtgatagcagaatca
acaactgtagactcaccgccctcatctccgcctccaccgcctccacctgcccaagccaca
acactctcatcaccagcaccagtaacagagccagtggccttgccacatacaccaataaca
gttctaatggcagcaccagtacccttaccagtagatgtagcagttagatctctgaaagaa
ccaccaattataattgtaccagaatctttagaagcagatactaagcaggatactgtatct
aatagttcagaagaacacataactcaaatattgaatgagcaagcagatatttcctcaaaa
aaagaagattcccatattgggaaggatgaagaaattccagatagttctaagattagtctg
agctgtaaaaaaacaggttctaagaagaaaccctcacaatctgaaggcatctttcttggt
tcagaatctgatgaagattctgtacggacttcttcaagtcaaagatcacatgatttaaaa
ttttcagcaagcattgaaaaggaaagagattttaaaaagagctcagcacctttaaaaagt
gaggatctagggaaatcttcacgatctaaaacagacagagatgataaatattttagctat
tcaaaacttgaaagagatactcggtatgtatcttcccgatgtagatcagaaagagagcga
cggcggagcagatctcattctaggtctgagagaggctctagaactaatttatcctattcc
aggtcagaacgatctcattattatgactctgatcgtcgctaccataggagctccccttat
cgagagaggacacgctattctcggccatacacagataacagagcacgagagagttctgac
tcagaagaagagtataagaagacatactcaaggcgtacctcatctcattcctcttcttac
agagacctaaggacatcatcctattctaaatctgatcgggactgtaaaactgagacctct
tacttagagatggaaagaagaggcaagtattcttcaaaactagaaagagaatctaaaagg
acttcagaaaatgaagcaattaaaagatgttgttctccacctaatgaactgggattccga
cgagggtcatcatattctaagcacgacagtagtgcttcccgttataaatctaccctttca
aaacctatacccaagtctgataaatttaaaaattctttctgttgtacagaattaaatgaa
gaaatcaaacagtctcattcttttagtttacagacaccttgttcaaaaggtagtgaatta
agaatgattaataaaaatcctgaaagagaaaaggctgggtctccagctccatcaaatcga
ttaaatgattcacctactttaaaaaagctagatgaattgcctatttttaagtccgaattt
ataacacatgatagccatgatagtattaaggaattagactctttatctaaagtgaagaat
gatcaattaagaagtttttgtcctatagaattaaatataaatggatctcctggggcagaa
tctgatttggcaacgttttgcacttctaaaactgatgctgttttaatgacttctgatgat
agtgtgactggatcggaattatctcctttggtcaaagcatgcatgctttcatcaaatgga
tttcagaatattagtagatgcaaagaaaaagacttggatgatacatgcatgctgcataag
aagtcagaaagcccatttagagaaacagaacctctggtgtcaccacaccaagataaactc
atgtctttgccagttatgactgtggattattccaaaacagtagttaaagaaccagttgat
acgagggtttcttgctgcaaaaccaaagattcagagatatactgtacttcgaacgatagc
aacccttctttgtgtaactccgaagctgaaaatactgagctttcggttatgaagatttct
tcaaatagctttatgaatgtgcatttggaatcaaaaccagttatatgtgatagtagaaat
ttgacagatcactcaaaatttgcatgtgaagaatataagcagagcatcggtagcactagt
tcagcttctgttaatcattttgatgatttatatcaacctattgggagttcaggtattgct
tcatctcttcagagtcttccaccaggaataaaggtggacagtctaactctcttgaaatgt
ggagagaacacatctccagttctggatgcagtgctaaagagtaaaaaaagttcagagttt
ttaaagcatgcagggaaagaaacaatagtagaagtaggtagtgaccttcctgattcagga
aagggatttgcttccagggagaacaggcgtaataatgggttatctgggaaatgtttgcaa
gaggctcaagaagaagggaattccatattgcctgaaagaagaggaagaccagaaatctct
ttagatgaaagaggagaaggaggacatgtgcatacttctgatgactcagaagttgtattt
tcctcttgtgatttgaatttaaccatggaagacagtgatggtgtaacttatgcattaaag
tgtgacagtagtggtcatgccccagaaattgtgtctacagttcatgaagattattctggc
tcttctgaaagttcaaatgatgaaagtgattcagaagatacagattcggatgacagcagt
attccaagaaaccgtctccagtctgttgtggttgtgccaaagaattctactttgcccatg
gaagaaacaagtccttgttcttctcggagcagtcaaagttatagacactattctgaccat
tgggaagatgagagattggagtcaaggagacatttgtatgaggaaaaatttgaaaatata
gcaagtaaagcctgtcctcaaactgataagtttttccttcataaaggaacagagaagaat
ccggaaatttcttttacacagtccagtagaaaacaaatagataaccacctgcctgaactt
tctcatcctcagagtgatggggttgatagtacaagtcatacagatgtgaaatctgaccct
ctgggtcacccaaattcagaggaaaccgtgaaagccaaaataccttctaggcagcaagaa
gagctgccaatttattcttctgattttgaagatatcccaaataagtcttggcaacagacc
actttccaaaacaggccagatagtagactgggaaaaacagaattgagtttttcttcctct
tgtgagataccacatgtggatggcttgcactcatcagaagagctcagaaacttaggttgg
gacttctctcaagaaaagccttctaccacgtatcagcaacctgacagtagctatggagct
tgtggtggacacaagtatcagcaaaatgcagaacagtatggtgggacacatgattactgg
caaggcaatggttactgggatccaagatcaggtagacctcctggaactggggttgtgtat
gatcgaactcaaggacaagtaccagattccctaacagatgatcgtgaagaagaggagaat
tgggatcaacgggatggatcccatttttcagaccagtccaataaatttcttctatccctt
cagaaagacaaggggtcagtgcaagcacctgaaataagcagcaattccattaaggacact
ttagctgtgaatgaaaagaaagatttttcaaaaaacttagaaaaaaatgatatcaaagat
agagggcctcttaagaaaaggaggcaggaaatagagagtgattctgaaagtgatggtgag
cttcaggacagaaagaaagttagagtggaggtagagcagggagagacatcagtgccccca
ggttcagcactggttgggccctcctgtgtcatggatgacttcagggacccacagcgatgg
aaggagtgtgccaagcaagggaaaatgccttgttactttgatcttattgaagaaaatgtt
tatttaacagaaagaaagaagaataaatctcatcgagatattaagcgaatgcagtgtgag
tgtacacctctttctaaagatgaaagagctcaaggtgaaatagcatgtggggaagattgt
cttaatcgtcttctcatgattgaatgttcttctcggtgtccgaatggggattattgttcc
aatagacggtttcagagaaaacagcatgcagatgtggaagtcatactcacagaaaagaaa
ggctggggcttgagagctgccaaagaccttccttcgaacacctttgtcctagaatattgt
ggagaggtactcgatcataaagagtttaaagctcgagtgaaggagtatgcacgaaacaaa
aacatccattactatttcatggccctgaagaatgatgagataatagatgccactcaaaaa
ggaaattgctctcgtttcatgaatcacagctgtgaaccaaactgtgaaacccaaaaatgg
actgtgaacggacaactgagggttgggttttttaccaccaaactggttccttcaggctca
gagttaacgtttgactatcagttccagagatatggaaaagaagcccagaaatgtttctgc
ggatcagccaattgccggggttacctgggaggagaaaacagggtcagcatcagagcagca
ggagggaaaatgaagaaggaacgatctcgtaagaaggattcagtggatggagagctagaa
gctctgatggaaaatggtgagggtctctctgataaaaaccaggtgctcagcttatcccgg
ctaatggttagaattgaaactttggagcagaaacttacctgtctggaactcatacagaac
acacactcacaatcctgcctgaagtcctttctggaacgtcatgggctgtctttgttgtgg
atctggatggcagagctaggtgacggccgggaaagtaaccagaagcttcaggaagagatt
ataaagactttggaacacttgcccattcctactaaaaatatgttggaggaaagcaaagta
cttccaattattcaacgctggtctcagactaagactgctgtccctccgttgagtgaagga
gatgggtattctagtgagaatacatcgcgtgctcacacaccactcaacacacctgatcct
tccaccaagctgagcacagaaactgacacagacactcccaagaaactaatgtttcgcaga
ctgaaaattataagtgaaaatagcatggacagtgcaatctctgatgcaaccagtgagcta
gaaggcaaggatggcaaagaggatcttgatcaattagaaaatgtccctgtagaggaagag
gaagaattgcagtcacaacagctactcccacaacagctgcctgaatgcaaagttgatagt
gaaaccaacatagaagctagtaagctacctacatctgaaccagaagctgacgctgaaata
gagcccaaagagagcaacgacacaaaactagaagaacctattaatgaggaaacaccatcc
caagatgaagaggagggtgtgtctgatgtggagagtgaaaggagccaagaacagccagat
aaaacagtggatataagtgatttggccaccaaactcctggacagttggaaagacctaaag
gaggtttatcgaattccaaagaaaagtcaaactgaaaaggagaacacaacaactgaacga
ggaagagatgctgttggcttgagagatcaaacacctgccccgaagactcctaataggtca
agagagagagacccagacaagcaaactcaaaataaagagaaaaggaaacgaagaagctcc
ctctcaccaccctcttctgcctatgagcggggaacaaaaaggccagatgacagatatgat
acaccaacttctaaaaagaaagtacgaattaaagaccgcaataaactttctacagaggaa
cgccggaagttgtttgagcaagaggtggcccaacgggaggctcagaaacaacagcaacag
atgcagaacctgggaatgacatcaccactgccctatgactctcttggttataatgccccg
catcatccctttgctggttacccaccaggttatcccatgcaggcctatgtggatcccagc
aaccctaatgctggcaaggtgctcctgcccacacccagcatggacccagtgtgttctcct
gctccttatgatcatgctcagcccttggtgggacattctacagaacccctttctgcccct
ccaccagtaccagtggtgccacatgtggcagctcctgtggaagtttccagttcccagtat
gtggcccagagtgatggtgtagtacaccaagactccagcgttgctgtcttgccagtgccg
gcccccggcccagttcagggacagaattatagtgtttgggattcaaaccaacagtctgtc
agtgtacagcagcagtactctcctgcacagtctcaagcaaccatatattatcaaggacag
acatgtccaacagtctatggtgtgacatcaccttattcacagacaactccaccaattgta
cagagttatgcccagccaagtcttcagtatatccaggggcaacagattttcacagctcat
ccacaaggagtggtggtacagccagccgcagcagtgactacaatagttgcaccagggcag
cctcagcccttgcagccatctgaaatggttgtgacaaataatctcttggatctgccgccc
ccctctcctcccaaaccaaaaactattgtcttacctcccaactggaagacagctcgagat
ccagaagggaagatttattactaccatgtgatcacaaggcagactcagtgggatcctcct
acttgggaaagcccaggagatgatgccagccttgagcatgaagctgagatggacctggga
actccaacatatgatgaaaaccccatgaaggcctcgaaaaagcccaagacagcagaagca
gacacctccagtgaactagcaaagaaaagcaaagaagtattcagaaaagagatgtcccag
ttcatcgtccagtgcctgaacccttaccggaaacctgactgcaaagtgggaagaattacc
acaactgaagactttaaacatctggctcgcaagctgactcacggtgttatgaataaggag
ctgaagtactgtaagaatcctgaggacctggagtgcaatgagaatgtgaaacacaaaacc
aaggagtacattaagaagtacatgcagaagtttggggctgtttacaaacccaaagaggac
actgaattagagtga

DBGET integrated database retrieval system