KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135397Help
Entry
101135397         CDS       T02442                                 

Gene name
TUFM
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Translation factors [BR:ggo03012]
 Eukaryotic Type
  Elongation factors
   101135397 (TUFM)
 Prokaryotic Type
   101135397 (TUFM)
Mitochondrial biogenesis [BR:ggo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    101135397 (TUFM)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101135397 (TUFM)
  Exosomal proteins of breast cancer cells
   101135397 (TUFM)
  Exosomal proteins of colorectal cancer cells
   101135397 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 101135397
NCBI-ProteinID: XP_004057461
Ensembl: ENSGGOG00000014136
UniProt: A0A2I2YVU5
LinkDB All DBs
Position
16
AA seq 455 aa AA seqDB search
MTTMAAATLLRATPHFSGLAAGRTFLLQGLLRLLKAPALPLLGRGLAVEAKKTYVRDKPH
VNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYST
AARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVV
VYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQ
KLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSK
NIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKPHQKVEAQVY
ILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILE
KGQRFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaatggcggccgccaccctgctgcgcgcgacgccccacttcagcggtctcgcc
gccggccggaccttcctactgcagggtctgttgcggctgctgaaagccccggcattgcct
ctcttgggccgtggcctggccgtggaggccaagaagacttacgtgcgcgacaagccacat
gtgaatgtgggtaccatcggccatgtggaccacgggaagaccacgctgactgcagccatc
acgaagattctagctgagggaggtggggctaagttcaagaagtacgaggagattgacaat
gccccggaggagcgagctcggggtatcaccatcaatgcggctcatgtggagtatagcact
gccgcccgccactacgcccacacagactgcccgggtcatgcagattatgttaagaatatg
atcacaggcactgcacccctcgacggctgcatcctggtggtagcagccaatgacggcccc
atgccccagacccgagagcacttattactggccagacagattggggtggagcatgtggtg
gtgtatgtgaacaaggctgacgctgtccaggactctgagatggtggaactggtggaactg
gagatccgggagctgctcaccgagtttggctataaaggggaggagaccccagtcatcgta
ggctctgctctctgtgcccttgagggtcgggaccctgagttaggcctgaagtctgtgcag
aagctactggatgctgtggacacttacatcccagtgcccgcccgggacttggagaagcct
ttcctgctgcctgtggaggcggtgtactccgtccctggccgtggcaccgtggtgacaggt
acactagagcgtggcattttaaagaagggagacgagtgtgagctcctaggacatagcaag
aacatccgcactgtggtgacaggcattgagatgttccacaagagcctggagagggccgag
gccggagataacctcggggccctggtccgaggcttgaagcgggaggacttgcggcggggc
ctggtcatggtcaagccgggttccatcaagccccaccagaaggtggaggcccaggtttac
atcctcagcaaggaggaaggtggccgccacaagccctttgtgtcccacttcatgcctgtc
atgttctccctgacttgggacatggcctgtcggattatcctgcccccagagaaggagctt
gccatgcccggggaggacctgaagttcaacctaatcttgcggcagccaatgatcttagag
aaaggccagcgtttcaccctgagagatggcaaccggactattggcaccggtctagtcacc
aacacgctggccatgactgaggaggagaagaacatcaaatggggttga

DBGET integrated database retrieval system