KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139512Help
Entry
101139512         CDS       T02442                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00511  Other glycan degradation
ggo00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101139512 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101139512 (NEU2)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     101139512 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 101139512
NCBI-ProteinID: XP_004033423
Ensembl: ENSGGOG00000005494
UniProt: G3QRW5
LinkDB All DBs
Position
2B
AA seq 380 aa AA seqDB search
MASLPVLQKESVFQSGAHAYRIPALLYLPGQQTLLAFAEQRASKKDEHAELIVLRRGDYD
APTHQVQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRAN
VTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYQEWSTFAVGPGHCLQLHDRARSLVVPAYA
YRKLHPIQRPSPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHL
RARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTH
SWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYE
EIVFLMFTLKQAFPAEYLPQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctccctgtcctgcagaaggagagcgtgttccagtcgggagcccatgcctac
agaatccctgccctgctctacctgcctgggcagcagaccctgctggccttcgcggaacag
cgggcaagcaagaaggatgagcacgcggagctgattgtcctgcgcagaggagactacgat
gcacccacccaccaggttcagtggcaagctcaggaggtggtggcccaggcccggctggat
ggccaccggtccatgaacccatgccccttgtatgacgcgcagacggggaccctcttcctc
ttcttcattgccatccctgggcaagtcacggagcaacagcagctgcagaccagggccaat
gtgacgcggctgtgccaagtcaccagcactgaccacgggaggacctggagctcccccaga
gacctcactgatgcggccatcggcccagcctaccaggagtggtccacctttgcagtgggc
ccggggcattgtttgcagcttcacgacagggcccggagcctggtggtgcccgcctacgcc
taccggaaacttcaccccatccaaaggccgagcccctctgccttctgcttcctcagccat
gaccatgggcgcacgtgggcgcgagggcactttgtggcccaggacaccctggagtgccag
gtggccgaagtcgagactggggagcagagggtggtgaccctcaacgcaagaagccacctc
cgagccagggtccaggcccagagcaccaatgacgggcttgatttccaggagtctcagctg
gtgaagaagctggtggagccgccgccccagggctgccaggggagcgtcatcagcttcccc
agcccccgctcggggcctggctccccagcccagtggctgctctacactcaccccacacac
tcctggcagagggccgacctgggtgcctacctcaacccgcgacctccagcccctgaggcc
tggtcagagccggtactgctggccaagggcagctgtgcctactcagacctccagagcatg
ggcaccggccctgatgggtcccccttgtttgggtgtctgtacgaagccaatgattacgag
gagattgtctttctcatgttcaccctgaagcaagccttcccagctgagtacctgcctcag
tga

DBGET integrated database retrieval system