KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139514Help
Entry
101139514         CDS       T02442                                 

Gene name
NEU4
Definition
(RefSeq) neuraminidase 4
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101139514 (NEU4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101139514 (NEU4)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     101139514 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
2B
AA seq 497 aa AA seqDB search
MMSSAAFPRWPQSMGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPD
DSHAHRLVLRRGTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTIFLFFIAVLG
HTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQL
PSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWHRGGLVPNLRSGECQLAV
VDSGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPA
PSRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAGDPRGGQVPGGPFSRLQPRADGPRQP
GPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWT
EPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPAS
PEPPNLGDKPRGCCWPS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctctgcagccttcccgaggtggccgcagagcatgggggtccctcgtacccct
tcacggacagtgctcttcgagcgggagaggacgggcctgacctaccgcgtgccctcgctg
ctccccgtgccccctgggcccaccctgctggcctttgtggagcagcggctcagccctgac
gactcccatgcccaccgcctggtgctgaggaggggcacgctggccgggggctccgtgcgg
tggggtgccctgcacgtgctggggacagcggccctggcggagcaccggtccatgaacccc
tgtcctgtgcacgatgctggcacgggcaccatcttcctcttcttcatcgcggtgctgggt
cacacgcctgaggccgtgcagatcgccacgggaaggaacgctgcgcgcctctgctgtgtg
gccagccgtgacgccggcctctcgtggggcagcgcccgggacctcaccgaggaggccatc
ggtggtgccgtgcaggactgggccacatttgccgtgggtcctggccacggcgtgcagctg
ccctcaggccgcctgctggtacccgcctacacctaccgcgtggaccgccgagagtgtttt
ggcaagatctgccggaccagccctcactccttcgccttctacagcgatgaccatggccgc
acctggcaccgtggaggcctcgtgcccaacctgcgctcaggcgagtgccagctggcggtg
gtggacagtgggcaggccggcagcttcctctactgcaatgcccggagcccactgggcagc
cgtgtgcaggcgctcagcactgacgagggcacctccttcctgcccgcagagcgcgtggct
tccctgcctgagactgcctggggctgccagggcagcatcgtgggcttcccagcccccgcc
cccagcaggccacgggatgacagttggtcagtgggccccgggagtcccctccagcctcca
ctcctcggtcctggagtccacgaacccccagaggaggctgctggagacccccgtggaggc
caggtgcctggtgggcccttcagccgtctgcagcctcgggcggatggccccaggcagcct
ggccccaggcctggggtcagtggggatgtggggtcctggaccctggcactccccatgccc
tttgctgccccaccccagagccccacgtggctgctgtactcccacccagtggggcgcagg
gctcggctgcacatgggtatccgcctgagccagtccccgctggacccgcgcagctggaca
gagccctgggtgatctacgagggccccagcggctactccgacctggcgtccatcgggccg
gcccctgaggggggcctggtttttgcctgcctgtacgagagcggggccaggacctcctat
gatgagatttccttttgtacattctccctgcgtgaggtcctggagaacgtgcccgccagc
cccgagccgcccaaccttggggacaagcctcgagggtgctgctggccctcctga

DBGET integrated database retrieval system