KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101141671Help
Entry
101141671         CDS       T02442                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00250  Alanine, aspartate and glutamate metabolism
ggo00410  beta-Alanine metabolism
ggo00430  Taurine and hypotaurine metabolism
ggo00650  Butanoate metabolism
ggo01100  Metabolic pathways
ggo04727  GABAergic synapse
ggo04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    101141671 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101141671 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101141671 (GAD2)
   00430 Taurine and hypotaurine metabolism
    101141671 (GAD2)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    101141671 (GAD2)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    101141671 (GAD2)
Enzymes [BR:ggo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101141671 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 101141671
NCBI-ProteinID: XP_004049230
Ensembl: ENSGGOG00000006775
UniProt: G3SJS2
LinkDB All DBs
Position
10
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SQPPRAAARKAACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMMIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccgggctctggcttttggtctttcgggtcggaagatggctctggggattcc
gagaatcccggcacagcgcgagcctggtgccaagtggctcagaagttcacgggcggcatc
ggaaacaaactgtgcgccctgctctacggagacgccgagaagccggcggagagcggcggg
agccaacccccgcgggccgccgcccggaaggccgcctgcgcctgcgaccagaagccctgc
agctgctccaaagtggatgtcaactacgcgtttctccatgcaacagacctgctgccggcg
tgtgatggagaaaggcccactttggcgtttctgcaggatgttatgaacattttacttcag
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattaccctaatgag
cttctccaagaatataattgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacaggacatcctagatacttcaat
caactttccactggattggatatggttggattagcagcagactggctgacatcaacagca
aatactaacatgttcacctatgaaattgctccagtatttgtgcttttggaatatgtcaca
ctaaagaaaatgagagaaatcattggctggccagggggctctggcgatgggatattttct
cccggtggcgccatatctaacatgtatgccatgatgatcgcacgctttaagatgttcccg
gaagtcaaggagaaaggaatggctgctgttcccaggctcattgccttcacatctgagcat
agtcatttttctctcaaaaagggagctgcagccttagggattggaacagacagcgtgatt
ctgattaaatgtgatgagagagggaaaatgattccatctgatcttgaaagaaggattctt
gaagccaaacagaaagggtttgttcctttcctcgtgagtgccacagctggaaccactgtg
tatggagcatttgaccccctcttagctgtcgctgacatttgcaaaaagtataagatctgg
atgcatgtggatgcagcttggggtgggggattactgatgtcccgaaaacacaagtggaaa
ctgagtggcgtggagagggccaactctgtgacgtggaatccacacaagatgatgggagtc
cctttgcagtgctctgctctcctggttagagaagagggattgatgcagaattgcaaccaa
atgcatgcctcctacctctttcagcaagataaacattatgacctgtcctatgacactgga
gacaaggccttacagtgcggacgccacgttgatgtttttaaactatggctgatgtggagg
gcaaaggggactaccgggtttgaagcgcatgttgataaatgtttggagttggcagagtat
ttatacaacatcataaaaaaccgagaaggatatgagatggtgtttgatgggaagcctcag
cacacaaatgtctgcttctggtacattcctccaagcttgcgtactctggaagacaatgaa
gagagaatgagtcgcctctcgaaggtggctccagtgattaaagccagaatgatggagtat
ggaaccacaatggtcagctaccaacccttgggagacaaggtcaatttcttccgcatggtc
atctcaaacccagcagcaactcaccaagacattgacttcctgattgaagaaatagaacgc
cttggacaagatttataa

DBGET integrated database retrieval system