KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145787Help
Entry
101145787         CDS       T02442                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    101145787
   04614 Renin-angiotensin system
    101145787
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101145787
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    101145787
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101145787
Peptidases [BR:ggo01002]
 Metallo Peptidases
  Family M2
   101145787
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101145787
CD molecules [BR:ggo04090]
 Proteins
  101145787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
5
AA seq 732 aa AA seqDB search
MGQGWATAGLPSLLFLLLCYGHPLLVPSQEAPQQVTVTHGTSSQATTSGQTTTHQATAHQ
TSAQSPNLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIA
NHTLKYGTQARRFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVA
TVCHTNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAAR
LNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGP
IPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDATEAMLKQGWTPRRMFKEADDFFTSLGLL
PVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQ
YFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMK
MALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPG
AKFHVPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLG
FSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSE
GPLPDSGRVSFLGLDLDAQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHG
PQFGSEVELRHS
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgggccagggttgggctactgcaggacttcccagcctcctcttcctgctgctctgctac
gggcaccctctgctggtccccagccaggaggcaccccaacaggtgacagtcacccatggg
acaagcagccaggcaacaaccagcggccagacaaccacccaccaggcgacggcccaccag
acatcagcccagagcccaaacctggtgactgatgaggctgaggccagcaagtttgtggag
gaatatgaccggacatcccaggtggtgtggaacgagtatgccgaggccaactggaactac
aacaccaacatcaccacagagaccagcaagattctgctgcagaagaacatgcaaatagcc
aaccacaccctgaagtacggcacccaggccaggaggtttgatgtgaaccagttgcagaac
accactatcaagcggatcataaagaaggttcaggacctagaacgggcagcgctgcctgct
caggagctggaggagtacaacaagatcctgttggatatggaaaccacctacagcgtggcc
actgtgtgccacacgaatggcagctgcctgcagctcgagccagatctgacgaatgtgatg
gccacatcccggaaatatgaagacttgttatgggcatgggagggctggcgagacaaggcg
gggagagccatcctccagttttacccgaaatacgtggaactcatcaaccaggctgcccgg
ctcaatggctatgtagacgcaggggactcgtggaggtctatgtacgagacaccatccctg
gagcaagacctggagcggctcttccaggagctgcagccgctctacctgaacctgcatgcc
tacgtgcgccgggccctgcaccgtcactacggggcccagcacatcaacctggaggggccc
attcctgctcacctgctggggaacatgtgggcacagacctggtccaacatctatgacttg
gtggtgcccttcccttcagccccctcgatggacgccacagaggccatgctaaagcagggc
tggacacccaggaggatgtttaaggaggctgatgatttcttcacctccctggggctgctg
cctgtgcctcctgagttctggaacaagtcgatgctggagaagccaaccgacgggcgggag
gtggtctgccacgcctcggcctgggacttctacaacggcaaggacttccggatcaagcag
tgcaccaccgtgaacttggaggacctggtggtggcccaccacgaaatgggccacatccag
tatttcatgcagtacaaagacttacctgtggccttgagggagggtgctaaccccggcttc
catgaggccattggggacgtgctagccctctcagtgtctacgcccaagcacctgcacagt
ctcaacctgctgagcagtgagggtggcagcgacgagcatgacatcaactttctgatgaag
atggcccttgacaagatcgcctttatccccttcagctacctcgtcgatcagtggcgctgg
agggtatttgatggaagcatcaccaaggagaactataaccaggagtggtggagcctcagg
ctgaagtaccagggcctctgccccccagtgcccaggactcaaggtgactttgacccaggg
gccaagttccacgttccttctagcgtgccttacatcaggtacttcgtcagcttcatcatc
cagttccagttccacgaggcactgtgccaggcagctggccacacgggccccctgcacaag
tgtgacatctaccagtccaaggaggccgggcagcgcctggcgaccgccatgaagctgggc
ttcagtaggccatggccagaagccatgcagctgatcacgggccagcccaacatgagcgcc
tcggccatgctgagctacttcaagccgctgctggactggctccgcacggagaacgagctg
catggggagaagctgggctggccgcagtacaactggacgccaaactctgctcgctcagaa
gggcccctcccagacagcggccgcgtcagcttcctaggcctggacctggatgcgcagcag
gcccgcgtgggccagtggctgctgcttttcctgggcatcgccctgctggtagccaccctg
ggcctcagccagcggctcttcagcatccgccaccgcagcctccaccggcactcccacggg
ccccagttcggctccgaggtggagctgagacactcctga

DBGET integrated database retrieval system