KEGG   Gekko japonicus: 107111950Help
Entry
107111950         CDS       T04299                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gja  Gekko japonicus
Pathway
gja04068  FoxO signaling pathway
gja04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:gja00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    107111950 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    107111950 (SOD2)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107111950 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 107111950
NCBI-ProteinID: XP_015268482
LinkDB All DBs
Position
Un
AA seq 224 aa AA seqDB search
MLCRLVYRGRHGPKLVAPLGCLASRQKHTLPDLPYDYGALVPHISAEIMQLHHSKHHATY
VNNLNVTEEKYKEALAKGDVTAQVSLQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELM
DAIKRDFGSFANFKEKLTAASVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLVP
LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSSRYVVSKS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctctgccggctggtctaccggggcagacatggccctaaactcgttgcacctcttgga
tgcctggcttccaggcaaaagcacacacttcctgacttgccttatgattatggcgccctg
gtaccccacattagtgcagaaatcatgcagcttcaccacagcaagcatcatgcgacttat
gtgaataatttgaatgttacagaagaaaaatacaaagaggccttggcaaaaggtgatgtt
acagctcaggtgtctcttcagccagctctgaagttcaatggcggaggtcacatcaatcac
tctatcttctggacaaacctttctccaaatggtggaggggagcctaaaggggagttaatg
gatgccattaagcgagattttggctcctttgcaaactttaaggagaaattgacagctgca
tccgttggtgtccaaggctcaggatggggatggcttggttttaataaagaacaaggtcga
ttgcagatagctgcttgttccaatcaagaccctctccaaggaaccactggtcttgttccg
ctgctagggattgatgtgtgggagcatgcctattatctgcagtataaaaatgtcagacct
gactatctcaaagctatctggaacgtgatcaactgggaaaacgtatcttcaagatatgta
gttagcaaatcatag

DBGET integrated database retrieval system