KEGG   Gekko japonicus: 107125675Help
Entry
107125675         CDS       T04299                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
gja  Gekko japonicus
Brite
Enzymes [BR:gja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     107125675 (ACE)
Peptidases [BR:gja01002]
 Metallo Peptidases
  Family M2
   107125675 (ACE)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107125675 (ACE)
CD molecules [BR:gja04090]
 Proteins
  107125675 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1285 aa AA seqDB search
MPPLRASLLLLLPLLLLLPARAAAWEAPPDPPRTEAGARLFASAYNGSAEAVFCATVSAS
WAYNTNLTAANAQQQVNSSLDEQEFIQAWGQKAKDSFGAIWQNFSDPQLKKIIRSVQTLG
PSNLPMDKRQLYNTILSEMDNIYSTAKVCPPNQNSSCWALDPEITDIMAASRSYRKLLYA
WESWHDAAGSPLRAKYEEFVSLSNEAYRMDGFKDTGDYWRSWYDSPTFEDDLEKLYHQLE
ELYLNLHAFVRRKLYERYGPRYINLQGPIPAHLLGNMWAQQWNNIYDMMIPFPDKPNLDV
TNTMKQKNWNATHMFRVAEEFFTSLGMLEMPPEFWESSMLEKPTDGREVVCHASAWDFYN
RKDFRIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVTFRSGANPGFHEAIGDVMSLSV
STPSHLEKIGLLDQVTEDADSDINYLLKMALEKIAFLPFGYLIDQWRWNVFSGRTPPNRY
NYDWWYLRTKYQGICPPVARNETHFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAA
NHTGPLHTCDIYQSREAGRKLSEALRAGSSERWQDILQQLTGTDQMDATALLDYFSPVTQ
WLKEQNGRMNETLGWPDFEWRPPIPEGYPAGIDKIADEAVAKEFLMEYNLTSEAVWNAYT
EASWAYNVNITDYNKQIMLEKNLEMSSHTLQYGLQARQFDPTDFQDPSIKRILKKLSDIE
RAALSEEELKEYNQLLSDMETTYSVAKVCNGEKGCKALDPELTDIMAQSRDYDELLNAWK
DWRDVSGKKIRSQYKRYVSLSNKAATLNGHADSGAFWRSLYESPTFEADLERIWQQLQPL
YLNLHAYVRRALHKTYGAEHINLKGPIPAHLLGNMWAQSWSNIFGLVMPFPDAIKVDATP
AMKSQGWTPKKMFEQSDSFFQSLGLIPMPPEFWNRSMLEKPADGREVVCHASAWDFYNRK
DFRIKQCTVVNMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVMALSVST
PKHLYSISLLDRVEDNLEGDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKDDEYNQ
QWWNLRLKYQGLCPPVPRSEEDFAPGAKFHVPANVPYVRYFVSFIIQFQFHQALCEAAGQ
VGPLHKCDIYQSKQAGTILGNAMKLGYSKPWPEAMQLITGQPNMSAEALLTYFHPLTNWL
INENMKNGETLGWPEYTWTPYAGQAQESSRVQFLGMSLDSNEAAVGLWTLLGLGLLLFIA
ALVLGARFLSDRSKIFSSNSEMELK
NT seq 3858 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgctccgcgcctcgctgctgctcctgctgccgctgctgctcctgctgccggcc
cgggccgcggcctgggaggcgccccccgaccccccgcgcaccgaggccggcgcccgcctc
ttcgccagcgcctacaacggcagcgccgaggccgtcttctgcgccaccgtctccgccagc
tgggcctacaacaccaacctcaccgccgccaacgcccagcagcaggtgaattcctctttg
gacgaacaggagtttatacaagcttggggacagaaagcaaaggacagttttggtgctata
tggcagaacttcagtgatcctcagctgaagaaaatcatccgctccgtccaaacattgggg
ccttctaatttacccatggataaacgacaactgtacaacaccatcttgagtgagatggac
aacatctactcaactgcaaaagtgtgcccaccaaaccagaactccagctgttgggccctt
gatccagagataacagacatcatggccgcctcccgcagttacaggaaactgctgtatgcc
tgggaaagttggcacgacgcagctggcagtcctctgagggccaagtacgaggagttcgtg
tccctaagcaatgaggcctacagaatggatggattcaaggatactggggattactggcgc
tcctggtatgattcacccacttttgaggatgatctggagaagctttatcatcagctggag
gagctctacctaaatctccatgcttttgtcaggaggaaactgtatgagcgatatggcccg
agatacatcaatctgcaaggccccattcccgctcacttactgggtaacatgtgggcccag
cagtggaacaacatttacgatatgatgattcctttcccagacaagcccaatctcgatgtc
accaatacaatgaaacaaaaaaattggaatgcaacacacatgttccgggtggcagaggag
ttcttcacgtcacttggcatgctggaaatgccacctgaattctgggagagctcaatgttg
gagaagccaacggatgggcgggaagtcgtctgccatgcatcagcgtgggatttctacaac
cgcaaagacttcaggataaagcagtgcacaacagtgaccatggagcagctcttcacagtc
caccacgagatggggcacgtggaatactacctgcagtacaaggaccagcctgtcactttc
cgcagtggtgccaaccctggcttccacgaagccataggagatgtcatgagcctgtctgtc
tctacccccagccacctggagaaaatcgggctgctcgaccaggtcactgaggatgcagac
agtgatatcaactatctcctgaaaatggccctggagaagattgccttccttccctttggc
tacctgatagatcagtggcgatggaacgtcttcagtgggcgcacccctcccaaccgttac
aattacgactggtggtatctcagaacaaaataccaggggatttgtcctccagtagcaaga
aatgagacacatttcgaccctggggccaaataccacatccctggaaacacgccttacatc
aggtactttgtcagtttcatcctgcagttccagttccacaaggccctctgccaggctgcc
aaccacaccggccctctccacacctgtgacatctaccagtccagagaagctggaaggaaa
ctcagcgaggcgctgagggctgggtcttccgagcggtggcaggatatcctccagcaactc
accggcacagaccagatggatgcgacggcactgctggactacttcagccctgtgactcag
tggctgaaggaacagaacggccggatgaatgaaacgctgggctggccggactttgagtgg
cgtcctcccatcccggagggatacccggcaggcatcgataaaatagccgatgaagccgtg
gccaaagagttcttgatggagtacaacctcacatctgaagcagtctggaatgcttacaca
gaggcctcgtgggcatacaatgtcaacatcacagactacaacaaacagatcatgttagaa
aagaatctggaaatgtcaagccacacgctgcaatatggcctgcaggctcggcagtttgat
ccgactgacttccaggaccccagcatcaagcgcattttaaagaagctgagtgacattgag
cgggcagccctgtctgaggaggagctgaaggagtataatcagctcctctcagacatggag
acgacttacagtgtagccaaagtctgcaatggagaaaaaggctgcaaggccctggatcca
gaacttacagacatcatggcccagtcaagagactacgacgaactccttaacgcctggaaa
gactggcgggacgtgtcagggaaaaaaatccgcagtcagtacaagagatatgtcagcctg
agcaataaagctgccacactgaatgggcatgcagacagcggtgctttctggaggtctctg
tatgaatcacccacatttgaagcggacctggagaggatctggcagcaacttcagccgtta
tacctcaacttgcacgcctacgtgcgcagggcactccacaagacctacggtgctgagcac
atcaacctcaagggcccaattccagctcatttgctagggaacatgtgggcccagtcgtgg
tcaaatatctttgggcttgttatgccctttcctgatgccatcaaagtggatgcgacgcca
gctatgaaaagtcagggctggaccccgaagaagatgtttgagcagtcggacagcttcttc
caatccctgggcctcatccctatgccaccggagttctggaaccggtccatgctggagaag
ccagcggatggcagggaagtggtgtgccacgcctcagcctgggacttctacaaccgcaag
gacttcaggattaaacagtgcactgttgtgaatatggatgatttgatcacggtccaccat
gaaatgggccacgtgcagtacttcctgcagtacaaagaccagcccatatccttccgcgat
ggggccaatccggggttccatgaagccatcggagacgtcatggccttgtcagtgtccacc
cccaaacacctgtacagcatcagtctcctggatcgggtagaagacaacctggagggtgac
attaactacttgatgagcattgcactggacaagattgcctttctgccctttggctacctc
atggaccagtggaggtggaaagtgttcgatgggcgcattaaggatgacgagtataaccag
cagtggtggaatctcagattgaagtaccaaggtttatgtccacctgtgcccagatcagaa
gaggattttgccccaggggcaaaatttcatgttcctgccaatgtcccttatgtcagatac
ttcgtcagtttcatcatccagttccagttccaccaagctctgtgcgaagctgctggccag
gtggggcccttgcacaagtgtgacatatatcagtcaaagcaggctggaacaattctgggg
aatgccatgaaactgggctacagcaagccatggcctgaagccatgcagcttatcacagga
cagcccaacatgtcggcagaagcattgctgacctatttccacccactaacaaactggcta
atcaatgagaacatgaaaaacggggaaaccctgggctggcctgaatacacctggacgccc
tacgcaggccaagcgcaagagagcagcagagtccagttcctgggcatgtctttggacagc
aacgaagcagcagtgggcctgtggaccttgctgggccttgggctgctcctcttcattgcc
gcgctagtcttgggggccagattcctctcagacaggagcaagatcttcagttctaactct
gaaatggagttgaaatag

DBGET integrated database retrieval system