KEGG   Geobacillus kaustophilus: GK2288Help
Entry
GK2288            CDS       T00217                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gka  Geobacillus kaustophilus
Brite
KEGG Orthology (KO) [BR:gka00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    GK2288
   04068 FoxO signaling pathway
    GK2288
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    GK2288
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    GK2288
   04212 Longevity regulating pathway - worm
    GK2288
   04213 Longevity regulating pathway - multiple species
    GK2288
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    GK2288
Enzymes [BR:gka01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GK2288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2321264..2322499)
Genome map
AA seq 411 aa AA seqDB search
MRGASTDGASSLLEFIAEHDGEWTEEAVRELQRLADDVYVGALRQYVMEAAAWGRQVEQA
LSARRMAEDVGLSSLLAYIDGHGDEWTEEAIYELQRLVDDVYTRAVRLADSSAADREEEA
TQEQVEGESVSPELESENKENEDGWLDTSGTAERVEDAKEPAFMAELSDSPTDAADGEPD
QADNVTDGKRRWVDADDGGEPRQQVAPGRHVLPPLPYRYDALEPHISEEIMRLHHTKHHQ
SYVDGLNQAERMMAEARRTNNFDLLKHWEREAAFHGSGHYLHTIFWYNMHPEGGGEPRGE
LRAQIERDFGSFTAFRRHFTEAAKSAEGVGWALLVWAPRAHRLEILQAEKHQLMAQWDVI
PLLVLDVWEHAYYLQYKNDRAAYIEHWWNVVNWRNVEERFHEAQKLRWQPF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtggggcaagcacggatggcgcttcgtcgctgctcgagtttattgccgagcatgac
ggcgagtggacggaagaggccgtccgcgagcttcagcgccttgccgatgacgtgtatgtc
ggtgcgcttcgccagtatgtcatggaagcggctgcgtggggaagacaagttgaacaggcg
ctgtctgcacgcaggatggctgaggatgttgggctttcgtctttgttggcgtacatcgat
ggacacggcgatgaatggaccgaagaagcgatttacgagctccagcgtcttgtcgatgac
gtatacactcgggccgtccgcctggctgattcgtcagctgccgatcgggaagaagaggcg
acgcaagaacaagtcgaaggggaatcggtgtcgcctgaactggagagtgaaaacaaagag
aacgaagacggatggcttgacaccagcgggacggcagagcgggttgaggacgcaaaagag
ccggcttttatggcggagctctccgactcgccgactgatgcagctgacggcgagccggat
caagcggacaacgtgaccgatggaaagcgacgctgggtggatgcggacgacggcggtgag
ccgcgtcaacaagtagcgcccggccgtcatgtcttgccgccgctgccgtaccgttatgat
gcgctcgagccgcatatttccgaagaaatcatgcgccttcaccatacgaagcatcatcaa
agctatgtcgacggtcttaatcaggcggagcggatgatggccgaggcgcgccggacgaac
aattttgatctgttgaaacattgggagcgggaagcggcgttccacggctccgggcattat
ttgcatacaatcttttggtacaacatgcatccagagggcggcggcgagccgcgcggggag
ctgcgggcgcaaatcgagcgcgattttggcagttttaccgcctttcgccgtcatttcacc
gaagcggcgaaaagcgccgaaggggtcggctgggcgctgctcgtttgggcgccgcgagcg
caccgtctggaaattttgcaggcggaaaaacaccagctcatggcgcaatgggatgtgatc
ccgcttctcgtgcttgatgtgtgggagcatgcctactatttgcaatacaaaaatgatcgg
gcggcgtacatcgaacattggtggaacgtcgtcaactggcgcaacgttgaagaacgcttt
catgaggcgcagaagcttcgttggcagccgttttaa

DBGET integrated database retrieval system