KEGG   Gloeobacter kilaueensis: GKIL_1557Help
Entry
GKIL_1557         CDS       T02885                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
glj  Gloeobacter kilaueensis
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:glj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GKIL_1557 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    GKIL_1557 (ppc)
   00680 Methane metabolism
    GKIL_1557 (ppc)
Enzymes [BR:glj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GKIL_1557 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1592590..1595403
Genome map
AA seq 937 aa AA seqDB search
MNWDSPIDLATAGSPAALSHQSLRENIELVEQLLRQVAFQEGGSELVELLERLWASQDGS
EEGLALIRALSLEQSVLAIRAFSIYFQLINIVEQHHERKLLRLQASFSADTAQPGSFCWL
FDELKSLGISSPEIERVLQQLDVRLVFTAHPTEIIRRTIRTKHRRIANLLDELDGALSEW
QQQQLRADILEVIQLWWRTDELHQVRPTVLDEVAHTVHYFEEVLFETLPRVRAELTRCLA
QFHPALTRSVGTFCRFGSWVGADRDGNPSVTALITWKTACYQRGVVLGKYLHSIERLRDR
LSVADSPPQDLILSLEEDQRALGEVYERYAIVYRQEPYRLKLSFILARLKRTRERNCWLE
EHGPQRLSQPDDPSWQHYYRDASEFLAELQLVQQCLRLTGLVCRELEMLIEQVGAFGFHL
AHLDIRQDSARHEETLSEVASRLRLLDKAYEDLSEIERREWLVRELQTLRPLIPAELPFS
ARTEETIQTFRMIRRLQKEFGTDICNTYIISMSRQASDLLEVLLLAEEAGLFDPATGTGS
LMVVPLFETIEDLRSAPEVLEQLFALPLYRCYLTCHGNLQEVMLGYSDSNKDSGFLASNW
EIFQAQQHIEQVARRHGVQLRIFHGRGGSVGRGGGPAYQAILAQPDGTVSGRIKITEQGE
VLASKYSLPELAAFNIETVVAAVVQASLLPASPPGSRSWELRMQELSDVARRTYRELIYE
QEGFIDFFCHVTPIDEIAQLQISSRPARREGRRDLASLRAIPWVFSWTQSRFLLPSWYGV
GTALAGFIDCNYERNLAELRSMYRNWPFFRAALSKVEMTIAKVDLGLARHYVQELLPEEY
VPAGRRIFRLIESEFERTEDALLLIAEHRHLLEDNPPLQRSIALRNASIAPLGYLQAILL
KYLRGTARTAHSYSRSELLRGALLTINGIAAGMRNTG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
gtgaactgggactcgccgatcgatcttgccactgctggttcgcccgcagcgctctcccac
cagtcgttgcgcgagaatatcgagctggtggagcaattgctcagacaggtggccttccag
gaaggtggcagcgaactggtcgaattgctcgaaaggctctgggcatctcaagacggcagc
gaggaagggctggcgctcatccgggcgctgtcgctcgaacagtcggtgctcgccattcgc
gccttctcgatctactttcagctcatcaacatcgtcgagcagcaccacgagcgcaagctg
ttgcggctgcaggcgagcttcagcgccgatacggcccagccgggctcgttttgctggttg
ttcgatgaactgaagagcctgggcatctcaagtcccgagatcgagcgcgtcctccagcag
ctcgacgtgcggctggtcttcaccgcccaccccaccgagatcatccggcggacgatccgc
accaagcaccgccggattgccaatttgctcgacgaactggatggtgccctctcggagtgg
cagcagcagcagctgcgcgccgacattctcgaggtgattcagctgtggtggcgcaccgac
gaattgcatcaggtgcggccaacggtgctcgacgaagttgcccacaccgtccattacttc
gaggaggtgctctttgagacgttgcccagggtaagggccgaactgacgcgctgtctggcc
cagtttcatccggctctcacccgctcggtcggcaccttctgtcgctttggctcgtgggtg
ggggccgaccgcgacggcaacccttcggtcaccgccttgatcacctggaagacggcctgc
taccagcgcggcgtcgtgctgggcaaatacctgcacagtatcgagcggttgcgcgaccgg
ctgagcgtggccgacagtccgccccaggatctgatcttgtcgctcgaagaggaccaacgc
gctctgggcgaggtctacgagcgctatgcgatcgtttaccggcaggagccttaccgcctc
aagctctcgtttatcctggcgcggctcaagcgcacccgcgagcgcaactgctggctggag
gagcacgggccgcagcgcctgagccagccggacgatccgtcctggcagcactactaccgc
gatgcgtcagaatttttggcggaactgcagctggtgcagcagtgcctgcggctgacgggg
ctggtctgccgcgagctggaaatgttgatcgagcaggtgggagcgttcggctttcacctc
gctcacctcgacatccgccaggacagcgcccgccacgaggagacgctctcagaagtggcc
tcccgcctgcgcctgctggataaagcctacgaggacttgtcggagatagaaaggcgcgag
tggctggtgcgcgagctgcagacgctgcgtccgctcatcccggcggagctaccgttctcg
gcgcgcaccgaagagacaatccagaccttccggatgatccggcggctgcaaaaggagttc
ggcaccgacatctgcaacacctacatcatctcgatgagccgccaggcgagcgacctgttg
gaggtgctgctcttagccgaagaagccgggctttttgatccggcgaccggcaccggcagt
ctgatggtcgtgcccctgtttgagaccatcgaagatctgcgcagcgccccggaggtgctg
gagcaactttttgccctgccgctgtatcgctgttacctcacctgccacggcaacctgcag
gaggtgatgctgggctactccgactccaacaaagattccgggtttctggcaagcaactgg
gagatcttccaggcccagcagcacatcgaacaggtcgcccgccgccacggcgttcaattg
cgaatctttcatggccggggtggttctgtgggccggggcggtggaccggcctaccaggcg
attctggcccagcccgacgggacggtgagtggccgcatcaagattaccgagcagggcgaa
gtgctcgcctccaagtactcgcttcccgaactggcggcttttaatatcgagacggtggta
gcggcggtggtgcaggcgagtctgctgccggccagcccccccggcagccgcagctgggag
ttgcggatgcaggagttgtcggatgtcgcccgccgcacctaccgcgagctgatctacgag
caggaaggctttatcgactttttctgccacgtcacccccatcgacgaaattgcccagttg
cagatcagctcccgccccgcccgccgcgagggccgccgggatctggcgagtctgcgggcg
attccctgggtcttttcctggacccagagccgctttttgctgccctcctggtacggcgtc
ggtacagccctggctggcttcatcgactgcaactacgagcgcaacctggcggagttgcgg
tcgatgtaccgcaactggcctttctttcgcgctgccctctccaaagtcgagatgacgatc
gccaaggtcgatctgggcctggcccgccactacgtccaggagttgctgcccgaggagtac
gtcccggcaggccggcggatcttccggctcatcgagagcgagttcgagcgcaccgaagac
gccctgttgctcatcgccgaacaccggcacctgcttgaggacaacccgcccctgcagcgc
tcgatcgccctgcgcaacgcttcgattgcgcctttaggctacttgcaggcaatcttgctc
aagtacctgcgcggtacggcccgcaccgcccattcctactcgcgcagcgagctgttgcgc
ggcgcactgctgacgatcaacggcatcgccgccggaatgcgcaatacgggctga

DBGET integrated database retrieval system