KEGG   Gloeobacter kilaueensis: GKIL_2224Help
Entry
GKIL_2224         CDS       T02885                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
glj  Gloeobacter kilaueensis
Brite
Enzymes [BR:glj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     GKIL_2224
Peptidases [BR:glj01002]
 Metallo Peptidases
  Family M2
   GKIL_2224
Exosome [BR:glj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GKIL_2224
CD molecules [BR:glj04090]
 Proteins
  GKIL_2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2339386..2341221
Genome map
AA seq 611 aa AA seqDB search
MNRNVYLVALLAALGSPVAATAPASAAPRLAFVQSVAEAQKFMQRAEGELAELNVKANRA
SWVGATYITDDTEALSADAQTNLNSAIQRFAIEAKRFDNLQMPPELARKFKLLKLNLIAP
PPSDSKEQQELTRLTVGMESEYGKGTYCRSPVDGKQECLQLNDLERILRTSRDPKELLDV
WQGWHQIARPLRPRYERFVQLSNKGARELGFADTGAMWRSNYDMSPAQFSAEVERLWQQV
RPLYLSLHAYVRTKLGEQYGTQLVPADGPIPAHLLGNMWAQEWGNIYPLAAPANDQRGYD
LTQLLTAKKVDEREMFRYGERFFTSLGFAPLPKTFWERSMLTKPRDRDVVCHASAWDIDN
LDDVRIKMCAEVTDSDFVTIHHELGHNFYQRAYKTQPPLFQNSANDGFHEAVGDTIALSV
TPDYLVKVGLLGKAPGPESDTGFLLKQALDKVAFLPFGLLIDQWRWKVFSGETQPKDYNK
SWWELRERYQGIAPPLARSEADFDPAAKYHVAANTPYIRYFLARILQFQFHRALCREAGY
TGPLHRCSIYANRAAGTKLAAMLAAGQSQPWPDTLYAMTGERQMDASAMLDYFAPLKSWL
DAQNQGKKVGW
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgcaatgtctatctggtcgccttgctggctgcgctgggcagcccggtggcggcg
acggccccagcatccgccgctccccgtctggcgttcgttcagtcggtggccgaggctcaa
aaattcatgcagcgcgccgagggcgaactggccgaattgaatgtcaaggccaaccgcgcc
agctgggtgggtgccacctacattaccgacgacaccgaagcgctctcagcggatgcccag
acgaacctcaattcagcgatccagcgctttgccatcgaggcgaagcgcttcgacaacctg
cagatgccgccggaactggcgcgcaagttcaagttgttaaagttgaacctgattgccccg
ccgcccagcgacagcaaagaacagcaggagttgacccggctgacggtcggcatggagagc
gagtacggcaaaggcacctactgccgctcgccagtagatggcaaacaggaatgcctgcag
ctcaacgacctcgagcgcatcctgcgcaccagccgcgatccaaaagaattgctcgatgtc
tggcagggctggcaccagattgcccggcccctgcgcccgcgctacgagcgctttgtgcag
ctttcaaataaaggggcgcgggagctgggcttcgcggataccggcgcaatgtggcgctcg
aactacgacatgagcccggcccagttcagcgccgaggtcgagcggctctggcagcaggtg
aggccgctctatctgtctctccacgcttacgtgcgcacaaaactgggcgagcagtacggt
acgcagctggtacctgccgacggtccgattccggcccatctgctgggcaacatgtgggcg
caggagtggggcaatatctatccgctggctgctccggccaacgaccagcgcggctatgac
ctcacccagctgttgacggccaaaaaagtcgatgagcgcgagatgttccgctacggcgag
cgcttctttacttccctcggttttgcgccgttgcctaaaactttctgggagcgctcgatg
ctcaccaaaccgagggaccgggacgtggtctgccacgccagcgcctgggacatcgacaac
ctcgacgacgtgcgcatcaagatgtgtgcggaggtgacggacagcgactttgtgaccatc
catcacgagttgggccacaacttttatcagcgcgcctacaagacccagcctcccctgttt
caaaacagcgccaacgacggcttccacgaggcggtgggagacacgatcgccctctcggtc
acccccgactatctggtcaaagtgggcctgctgggtaaagctcccggtcccgaatcggac
acaggcttcctgctcaagcaggcgctcgacaaggttgccttcttgcccttcggcctgctc
atcgaccagtggcgctggaaggtcttctcaggcgaaacccagcccaaagattacaacaag
agctggtgggagttgcgcgagcgctaccaggggatcgcaccgcctttggcccgcagcgaa
gccgactttgacccggcagccaagtaccacgttgcggccaatacgccctacatccgctac
tttctggcgaggatactgcagtttcagttccaccgggcgctctgccgcgaggcgggctat
accggtcccttgcatcgctgctcgatctatgccaaccgcgctgctgggacaaaactcgca
gcgatgctcgccgccggtcagagccaaccctggcccgatacgctctacgcgatgacgggc
gagcgccagatggacgcctcggccatgctcgactacttcgcgccgctcaaaagctggctt
gacgcccagaaccagggcaaaaaagtcggctggtag

DBGET integrated database retrieval system