KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0554Help
Entry
GY4MC1_0554       CDS       T01348                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Brite
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GY4MC1_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu AHSA1 FlgD_ig
Motif
Other DBs
NCBI-ProteinID: ADP73386
UniProt: A0A0F6BIY5
LinkDB All DBs
Position
582686..583210
Genome map
AA seq 174 aa AA seqDB search
MFQKAGLLFAAAVLFAVGCQKENVTNLEVNMINSAGDSIGTVKLTEQAKGVKLKLDLEGL
PPGEHAIHIHEKGVCKKPDFQSAGNHYNPDGKKHGLLHPEGAHAGDLPNIIVKEDGTVNT
ELTAPNVTLKEGKKGTLLTKDGTAIVIHAGKDDGMTQPAGDAGERIACGEIKNR
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcaaaaggcaggtttgttattcgcggccgccgttttatttgccgtcggctgccaa
aaggaaaatgtgacgaatttagaagttaacatgataaatagcgccggtgattccatcggc
acggtgaagctaaccgaacaagcgaaaggggtgaaattgaagctggatttggaagggctt
ccgcctggtgaacacgcgattcatattcacgaaaaaggagtttgcaaaaaaccggatttt
caatcggctggaaaccactacaatccagacggaaaaaaacatggattgcttcatccagaa
ggagcgcatgctggcgacttgcctaatattatcgtaaaagaggacgggacagttaacacg
gaattgaccgcgccaaatgtgacgctgaaagaaggaaaaaaagggacgttgttaactaaa
gatgggacggcgattgtcatccacgccggaaaagatgatgggatgacgcagccggctgga
gatgctggggaacgaattgcatgtggagaaataaaaaatagatga

DBGET integrated database retrieval system