KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0649Help
Entry
GY4MC1_0649       CDS       T01348                                 

Definition
(GenBank) Protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
gmc  Geobacillus sp. Y4.1MC1
Brite
Enzymes [BR:gmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     GY4MC1_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(652222..653043)
Genome map
AA seq 273 aa AA seqDB search
MIQIQQTIVNNDFLAHSSLSKKQEKIFEALLKSQKTYVYKNKHQLLFEIILRDRIIDAAI
LLAKSKARFTIFRFSRCNEQFWTKNDLGGFQLKQGILPSDAINDIFINSQLYAFECATAI
VIVFYKAVLDVIDKQKFNTLFSNLLLYDWHVDEDLGIKTKKGEDYLPGDCLYFKNPDFDP
QTPQWQGENTIYLGNGLHYGHGIGIKTKEEIIDTLNRKRKRNATKSAYLLPQTTRVNFIY
LSQFANSLENYRLPINHQYFITGALGSATFLHW
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaattcaacaaacgattgtgaataatgacttccttgcgcattcttctctttca
aaaaaacaagaaaaaatatttgaagcattattaaaatcacaaaaaacctacgtatataaa
aacaaacatcagctgttattcgaaattattttgcgcgaccgcattatcgatgcggctatt
ttgctcgcaaaaagcaaagcaaggtttaccatttttcgtttttcgagatgcaatgagcaa
ttttggacaaaaaatgatctgggtggttttcaattaaaacaaggcatccttccttcggat
gcgataaatgatattttcatcaacagccagttgtatgcctttgagtgcgctaccgccatc
gttatcgtgttttacaaagcggtattagatgtcattgataaacaaaaatttaacacattg
ttttccaatctcttattatacgactggcatgttgatgaagacttagggatcaaaacaaaa
aagggagaagattatctcccaggcgactgtctttattttaaaaatcctgacttcgatccg
caaacgccgcaatggcagggcgaaaacacgatttatttaggaaacggccttcattacgga
cacggaataggaattaaaacaaaagaagaaatcattgacactttaaatagaaaaagaaag
aggaacgctacaaagtcagcctatttgcttccgcaaacaacaagagtcaattttatttat
ttatctcagtttgccaacagcttagaaaattatcgtcttcctattaaccatcaatatttt
attaccggggcgctcgggtcagctactttcttgcactggtag

DBGET integrated database retrieval system