KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1108Help
Entry
GY4MC1_1108       CDS       T01348                                 

Definition
(GenBank) Manganese/iron superoxide dismutase-like protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Brite
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GY4MC1_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1106857..1107471
Genome map
AA seq 204 aa AA seqDB search
MAFELPQLPYAYDALEPYIDKETMNIHHTKHHNTYVTNLNAALEGHADLQNKSLEELLSN
LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELAEAINKKFGSFAAFKEEFT
KAATTRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRPE
YIAAFWNIVNWDEVAKRYSEAKAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgccacaattaccttatgcttatgatgcgcttgagccgtatatcgac
aaagaaacgatgaacattcaccacacgaaacaccataacacttatgtaacaaacttaaat
gctgctttagaaggacatgcggatttacaaaataaatcgcttgaagaattgctcagcaat
ttagaagcacttccggaaagcatccgcacagcggtccgcaacaacggcggcgggcacgca
aaccattctctcttctggacgattctttcgccaaacggtggcggcgagccaacgggagaa
ttagcggaagccattaacaaaaaattcggcagctttgcagcgttcaaagaagaatttaca
aaagcagcgacgactcgcttcggttccggatgggcttggctcgttgtcaacaacggcgaa
cttgaagtgacaagcacgccaaaccaagactcgccattgatggaaggaaaaactccgatt
cttggcttagacgtttgggaacatgcttactatttgaaatatcaaaaccgtcgtccagaa
tatattgcagcattctggaacattgtgaactgggatgaagtagcaaaacgctacagcgaa
gcaaaagcgaaataa

DBGET integrated database retrieval system