KEGG   Geobacter metallireducens: Gmet_0611Help
Entry
Gmet_0611         CDS       T00295                                 

Gene name
tuf-2
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
gme  Geobacter metallireducens
Brite
Translation factors [BR:gme03012]
 Eukaryotic Type
  Elongation factors
   Gmet_0611 (tuf-2)
 Prokaryotic Type
   Gmet_0611 (tuf-2)
Mitochondrial biogenesis [BR:gme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Gmet_0611 (tuf-2)
Exosome [BR:gme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Gmet_0611 (tuf-2)
  Exosomal proteins of breast cancer cells
   Gmet_0611 (tuf-2)
  Exosomal proteins of colorectal cancer cells
   Gmet_0611 (tuf-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
682481..683671
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITRVLAERGQAEFKGFDQIDNAPEERERG
ITIATSHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDEELLELVELEIRELLSSYDFPGDDIPIIKGSALKALN
GDKDELGSEAIVKLMDAVDAYIPEPERAIDKPFLMPVEDVFSISGRGTVATGRVERGVVK
VGEEVEIVGIKTTTKTTVTGVEMFRKLLDEGRAGDNIGALLRGVKREDIERGQVLARPGS
ITPHTKFKAEAYILTKEEGGRHTPFFNGYRPQFYFRTTDVTGIVDLPAGTEMVMPGDNVA
VTVNLITPIAMDEGLRFAIREGGRTVGAGVVSSIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcaaaattcgagagaacaaaaccgcacgtcaacatagggacgattggtcac
gttgatcatggcaagaccacgctgaccgccgccatcacgcgggttctggccgagcgcggc
caggccgaattcaagggctttgatcagatcgacaacgcccctgaggagcgtgagcgtggt
atcaccatcgccacctcgcacgttgagtatgaaaccgaaaagcgtcactatgctcacgtt
gactgtcccggccacgctgactacgtcaagaacatgatcaccggtgcggctcagatggac
ggcgcgattctcgttgtctccgccgccgacggccccatgccccagacccgcgagcacatt
ctgcttgctcgtcaggtaggggttccctacatcgttgtgttccttaacaaggctgacatg
gtcgatgacgaagagcttcttgagctcgtcgagctggagattcgcgaactgctctcctcc
tatgatttcccgggcgacgacattcccatcattaagggttccgccctcaaggccctcaat
ggcgacaaggacgagctcggctctgaagccatcgtcaagctcatggacgccgtcgacgcc
tatattcccgagcctgagcgcgccatcgacaagccgttcctgatgcccgtcgaagacgtc
ttttccatctccggtcgcggtaccgttgccactggtcgggttgagcgtggcgttgtcaag
gtgggcgaggaagtcgagatcgttggaatcaagacgaccaccaagaccactgttaccggt
gtagaaatgttccgcaagctcctcgatgaagggcgtgccggcgacaacatcggcgccctg
ctccgtggtgtaaagcgtgaagacatcgagcgtggccaggtgctggcgaggccggggagc
atcaccccgcacaccaagttcaaggccgaggcctacattctgaccaaggaagaaggcggg
cgccacaccccgttcttcaacggctatcgtccgcagttctactttcggaccaccgacgtg
accggcatagtagaccttcccgcagggaccgaaatggtcatgcccggcgacaacgtagcc
gtaacggttaacctgatcaccccaatcgccatggacgaaggcctgcggttcgctatccgt
gagggtggccgtactgtcggcgccggtgttgtcagctctatcatcgaataa

DBGET integrated database retrieval system