KEGG   Glycine max (soybean): 100305732Help
Entry
100305732         CDS       T01710                                 

Definition
(RefSeq) uncharacterized LOC100305732
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100305732
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100305732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 152 aa AA seqDB search
MVKAVAVLGSSEGVTGTIHFVQEGSGPTTVTGSLAGLKPGLHGFHVHALGDTTNGCLSTG
SHFNPNNKEHGAPEDVNRHAGDLGNVNVGDDGTVSFTITDSQIPLTGPNNIIGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggccgttcttggcagcagtgagggtgtcactggaactattcacttc
gttcaggagggaagtggtccaaccaccgtaactggatctcttgctggtcttaagcctggt
ctccatggtttccatgtccatgccttgggggacactaccaatggttgcctctcaactgga
tcacatttcaatcctaataacaaggagcatggtgcccctgaggatgtgaatcgtcatgct
ggtgatcttgggaatgttaatgtcggtgatgatggtactgtcagcttcactattactgac
agccagattcctctcactggaccaaacaacatcataggaagggcggttgttgtccatgct
gatcctgatgatcttgggaaaggtggtcatgagcttagcaaaactactggaaatgctggt
ggcagagtagcttgtggtatcattggtctgcaaggataa

DBGET integrated database retrieval system