Glycine max (soybean): 100791702 Help Entry 100791702         CDS       T01710                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism gmx  Glycine max (soybean) Pathway gmx04016   MAPK signaling pathway - plant gmx04070   Phosphatidylinositol signaling system gmx04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:gmx00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     100791702    04070 Phosphatidylinositol signaling system     100791702  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     100791702  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gmx01009]     100791702   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmx04131]     100791702    03036 Chromosome and associated proteins [BR:gmx03036]     100791702   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmx04147]     100791702 Protein phosphatases and associated proteins [BR:gmx01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100791702 Membrane trafficking [BR:gmx04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100791702 Chromosome and associated proteins [BR:gmx03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100791702 Exosome [BR:gmx04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100791702 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M EFhand_Ca_insen Dockerin_1 RNA_pol_Rpb4 Caleosin Poly_export MotA_activ DUF6279 PA_Ig-like Fe_hyd_lg_C SurA_N_3 MecA_N RTX_C Motif Other DBs NCBI-GeneID:  100791702 NCBI-ProteinID:  XP_003545473 UniProt:  Q6LEG8 Structure PDB LinkDB All DBs Position 14:3039699..3041909 Genome browser AA seq 149 aa AA seqDB search MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctcaccgacgaacagatctctgagttcaaggaagcctttagcctcttc gacaaggacggcgatggttgtattaccaccaaggaacttgggactgtgatgcggtcgctt gggcagaacccaactgaggctgagctgcaggacatgataaatgaggttgatgctgatggg aatggtaccattgatttcccagaattcctcaatctcatggcgcgcaagatgaaagacact gattcagaggaagagctgaaggaggctttccgtgtgtttgacaaggatcagaatggtttc atctctgcagcagagctccgccacgtaatgaccaatctcggtgagaagctgactgatgag gaagtcgatgagatgattcgtgaggctgacgttgatggtgatgggcagatcaactacgag gagtttgtcaaagtcatgatggccaagtga

DBGET integrated database retrieval system