KEGG   Glycine max (soybean): 100810333Help
Entry
100810333         CDS       T01710                                 

Definition
(RefSeq) alpha-amylase 3, chloroplastic-like
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 928 aa AA seqDB search
MSTVALETLFPLCRRKPSFHRHKPIPLRPFFVTCSSNLNDDASFIFHQQPRKTLSPVHAV
SHTDTSVLHSLQCPHTITNTFLINTTETVEGKIFVRLDHGKGLRDRELTVGCNLPGKWIL
HWGVTYVDDVGREWDQPPRDMIPPGSILIKDYAIETPLKESSLSAEGDTLHEIRIDLKAN
NGIAAINFVLKDEETEAWYKNKRRDFKVSLVNNLKEDNSIIGPKWGFDLWPGNLGQISKM
FLQSEEADQDDSSESRVPEQDNNQPESFCEEVPITKKVLVQNSISVSTTKCHESGAVKEL
LLLETDLPGDVVLHWGVCRDDSRKWEVPPRPHPPGTVAFKERALRTQFRPRDDGKGSLAL
ITLEEEFSGFMFVLKQNENTWFKYNGHDFYIPLSSSSSFLNSGNKEGQSEGMQREVTQEA
SQKSSFFAFTDTITNEIRNLVTDNSSEKIQRTKSKMAQRSIFQEIERLAAEAYNIFRISI
PTFSEETAAEPEVTIVEPETSIVEPQATTIVIPETSVESETQSLDPKICSGTGTGYEILC
QAFNWESHKSGRWYIELKEMASELASLGFTVVWLPPPTESVSPEGYMPKDLYNLNSRYGN
IDELKDLVKRFHEVGIKVLGDAVLNHRCAHYQNQNGIWNIFGGPLNWDDRAVVADDPHFQ
GRGNKSSGDNFHAAPNIDHSQEFVRKDLKEWLCWLRKEVGYDGWRLDFVRGFWGGYVKDY
IDASEPYFSVGEYWDSLSYTYSEMDHNQDAHRQRIIDWINATNGTSGAFDVTTKGILHPA
LERCEYWRLSDEKGKPPGVLGWWPSRAVTFIENHDTGSTQGHWRFPSGKQMQGYAYILTH
PGTPSVFYDHISSHDKSEIASLISLRKRNKIHCRSRVQISKAEKDVYAAIIDEKVAMKIG
PGHFEPPSDSQKWSLAIEGKDYKIWEAS
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgttgcattagagactctcttccctctttgccgtagaaaaccttcatttcac
cgccataaaccaatccctctcagacccttctttgtgacttgctcttccaacctcaatgat
gatgcatccttcatcttccaccaacaacctcgcaaaactctctctcccgtgcatgcagtt
tcccacacagacacatctgtcctccactcccttcaatgccctcacaccatcaccaacact
ttcctaatcaacacaaccgaaacggtggagggaaagatttttgtgagattagatcacgga
aagggtttgagggatcgggagcttacggtgggttgcaatcttcccggaaaatggattctt
cattggggagttacctatgttgatgatgttggaagggaatgggatcaacctcctcgtgat
atgataccccccggatctattcttataaaggactatgcaatagagacccctttgaaggag
tcatccttatccgccgaaggagatacgcttcacgaaatcaggattgatcttaaagccaac
aatggaattgcagcgattaattttgttctcaaggatgaggaaaccgaagcttggtacaaa
aacaaaagaagagatttcaaggtttctttggtcaacaaccttaaggaggataatagcata
attggacctaaatggggctttgatttatggccagggaatttgggacagatatctaaaatg
ttcctccagtcagaagaagctgaccaagatgacagcagtgaatctagagttccagagcaa
gacaataatcaaccagaaagtttttgtgaagaagtgcctataacaaagaaggttttagtc
caaaactctatcagtgtctccaccacaaaatgccatgagtctggggcagttaaggaactt
ttacttttggaaactgatctacctggagatgttgtccttcactggggagtttgtagggat
gattcgagaaagtgggaagttccacctcgtcctcatccaccaggaacagtagcatttaaa
gaaagggctttgagaactcaatttcggccaagagatgatggaaaaggatctttagcacta
atcactttagaggaagaattttcaggctttatgtttgttcttaagcaaaatgaaaatact
tggttcaagtacaatggacatgatttttatatccccctctcaagttctagtagctttctt
aatagtggcaacaaagagggccagtcagaaggtatgcagagggaagtgactcaagaggct
agtcaaaagagttctttctttgcatttactgatacaataaccaatgaaataagaaatttg
gtcacagacaattcctctgagaagattcaaaggacaaaatcaaaaatggcacaacgaagc
atttttcaagaaattgaaaggctggctgctgaagcctataatatattcagaatctccatt
ccaactttctctgaggaaactgctgcagaacctgaggtaactattgtggaacctgagaca
agtattgtggaacctcaggcaacaactattgtgatacctgagacttcagtggaatcagag
acacagtccctggatccaaaaatatgctcaggaacaggcacagggtatgaaatattatgc
caagcgtttaactgggaatctcacaaatctggaagatggtacatagagcttaaagaaatg
gcttcagaactagcatcacttggtttcactgtggtttggttgccaccacctactgaatct
gtttcacctgaaggatacatgccaaaggatttatataatttaaattccagatacggaaac
attgatgaactgaaagatttggtgaaaagatttcatgaagttgggatcaaagttcttgga
gatgccgttttaaaccaccgctgtgctcactatcagaatcaaaatggtatttggaacata
tttggaggccctcttaactgggatgatcgtgcagttgtagctgatgatccacattttcag
ggcaggggcaacaagagtagtggagataattttcatgccgctccaaacattgatcattct
caggagtttgtgagaaaggatctcaaagaatggttatgctggttgaggaaagaagttggg
tatgatggatggaggcttgactttgtgagaggattttggggtggttatgtaaaggactac
atagatgcaagtgaaccttatttttccgtgggagagtactgggattccctcagttataca
tatagtgaaatggatcataatcaagatgctcataggcagaggataattgattggatcaat
gccactaatggtacctctggtgcatttgatgtcacaacaaaaggaattcttcaccctgca
ttggaaagatgtgaatattggcgattgtcagatgagaagggaaagcccccaggcgttctt
ggctggtggccatctcgagctgttacgtttatagagaatcatgacactggttccacccag
ggtcattggagatttcccagtggaaaacaaatgcaaggatatgcctacattcttactcac
ccaggaactccatcagtgttttacgaccacatttcctctcacgataaaagtgaaatagca
agtctaatatctctcaggaagaggaacaagatccactgcaggagtagagttcaaattagt
aaagcagaaaaggatgtttatgcagcaatcatagatgagaaagtagctatgaagattgga
cctggacattttgaaccaccaagtgactcccagaaatggtcattagctattgagggaaaa
gactataagatttgggaagcatcataa

DBGET integrated database retrieval system