KEGG   Glaciecola nitratireducens: GNIT_2270Help
Entry
GNIT_2270         CDS       T01632                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gni  Glaciecola nitratireducens
Brite
Enzymes [BR:gni01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GNIT_2270 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEP30371
UniProt: G4QKR8
LinkDB All DBs
Position
2511540..2512121
Genome map
AA seq 193 aa AA seqDB search
MAFELPALPYEKNALEPHISAETLEFHYGKHHATYVTKLNGLVEGTDLATKSLEEIVKNS
DGGVFNNAAQIWNHTFYWNSLSPNGGGEPTGALADAINAKWGSFADFKAAFNDKAVNNFG
SSWTWLVKTADGKLDIVNTSNAGTPITEEGVTPLLTCDLWEHAYYIDYRNVRPNYLEAYW
ALANWDFAASNFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattacctgcactaccttatgaaaaaaatgcactggaaccacacatttct
gcagaaacattagaatttcattatggtaagcatcacgcgacatacgttactaagttaaac
ggtttagttgaagggactgatttagctacaaaatcacttgaagaaatagtgaaaaattca
gatggtggtgttttcaacaatgctgcacaaatttggaatcatacattttattggaatagc
ctaagtcctaatggcggcggcgaacctactggcgcacttgccgacgcgatcaacgcaaag
tggggttcatttgctgactttaaagctgcttttaacgacaaagctgtaaataacttcggt
tcaagctggacttggttagtaaaaacagctgacggtaaactagatatcgtaaacacaagc
aacgcgggcacgccaatcactgaagaaggtgtaacacctctactaacatgtgatttgtgg
gaacacgcctactacatcgattatcgcaatgttcgtccaaattacttggaagcatattgg
gcacttgctaactgggattttgctgcaagcaacttcgcataa

DBGET integrated database retrieval system