KEGG   Gluconobacter oxydans H24: B932_2322Help
Entry
B932_2322         CDS       T02348                                 

Definition
(GenBank) DDl
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
goh  Gluconobacter oxydans H24
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B932_2322
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B932_2322
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B932_2322
Enzymes [BR:goh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B932_2322
Peptidoglycan biosynthesis and degradation proteins [BR:goh01011]
 Precursor biosynthesis
  Amino acid ligase
   B932_2322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2322321..2323232)
Genome map
AA seq 303 aa AA seqDB search
MKVAVLYGGTSNERPVSLASGEPAINALRDKGHDVIPVDVGPDIAVTIQALKTAAPDVVF
NALHGPKGEDGAIQGVLEWLGIPFTHSGIRASAVAMDKGATRILLAAAGLPVAEGRVVTA
TELAEADPLPVPYVIKPVAEGSSVGVEIIRAGDNRRAEIARTWRFGKEALVESFIPGREL
TASVMGDRALAVTDILPAETAAFYDFEAKYKAGGSRHVVPADLPESVTARALDYALRAHQ
TLGCAGASRTDFRYDDETDTLIILEVNTQPGMTPTSLLPEQAAYCGISYSDLCDWMVREA
LNR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgcagttctttatggcggtacgtccaatgagcgacctgtcagtctcgcaagt
ggtgaaccagccatcaacgcccttcgcgacaaaggccatgacgtcattccggtggatgtt
gggccggatattgccgttacgatccaagccctgaaaaccgcggctccggacgtcgtcttc
aatgctcttcatggcccgaagggagaagacggcgccatccagggcgttctggagtggctg
ggcattccctttacccattccggcatccgggcatctgccgttgccatggacaagggagcg
acacgtatccttcttgccgcagcgggcctgccggttgcagaaggccgtgtcgtgacagct
accgaacttgccgaagccgatccccttcccgtcccttatgtgatcaagcctgttgcagaa
gggtcttccgttggtgtcgagatcatccgtgcaggtgacaaccgccgcgccgaaatcgcg
cggacatggcgttttggcaaggaagcccttgttgagagctttatccccggacgtgaactg
acggccagcgtcatgggagatcgtgcacttgccgtgaccgatatcctgcccgccgaaacc
gcggcattttacgattttgaagccaagtacaaggctggtggttcacgtcacgtcgtgcct
gctgacttgcctgaaagtgtcacggcacgtgcgcttgattacgctttgcgcgctcatcag
acactgggttgcgccggggccagccggacagattttcgctatgatgacgaaaccgacacg
ctcatcattctcgaagtcaacacacagcctggtatgactccaacgtccctgttgccagaa
caggctgcctattgtggtatttcctattcagacctgtgtgactggatggttcgggaggca
ctgaaccgctga

DBGET integrated database retrieval system