KEGG   Gordonia phthalatica: ACH46_19695Help
Entry
ACH46_19695       CDS       T04097                                 

Definition
(GenBank) DNA polymerase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
goq  Gordonia phthalatica
Pathway
goq03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:goq00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    ACH46_19695
Enzymes [BR:goq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ACH46_19695
DNA repair and recombination proteins [BR:goq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ACH46_19695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DAZAP2 DNA_primase_S DUF150
Motif
Other DBs
NCBI-ProteinID: ALG87066
UniProt: A0A0N9MV16
LinkDB All DBs
Position
4192577..4194529
Genome map
AA seq 650 aa AA seqDB search
MTRSQLEVDGRRIALSNLEKVLYPETGTRKFDVVDYCIRIADAMLPHLASRPVTRKRWPG
GTESAPFFEKTLPAGTPEWIARFTIEHSERKTGYPVVRSAADLVWLAQVAALELHVPQWR
IDLSDDIDRRTDRIVLDLDPGPDVSLDECARVAVDIRDLLDDAGLSSFPVTSGSKGIHVY
ARLSTLVKSESARAVAKQIATAMAQAAPRTVTATMAKAQREGRVFIDWSQNTAAKTTLAP
YSLRGQPRPYAAAPRTWDELAEPGLSQLEFTEVLDRYDEVGDLLAGLSGEVAAVAVDHAA
GGSDVIDLGEYRKKKSSRRASSKPTPAPPGPTERQPIPSGLTELRPMLATDDPIDGLDDD
WAYEGKWDGFRALVRVVGGRARLISRSGNDLTGDFPELSVIADCLVRDGKPVDAVLDGEI
VALNAAGISDFSLLVSRKRTSEPYELRLHLFDVLYLDGVDLTEQPWEVRREILDALTYFD
GESVIDIPPLLPGPAETAVAVARERGWEGVVAKRRAARYVSGRRSPDWRKQKNWNSVEVV
IGGYRPGRGSESKIGSLLVGVPAERGLRYLGRVGTGFTDAELDALLEELRPLRISMCPFV
DDIDKPVAGSATWVLPKLVADVAFMDWTSTGHLRHPTWRGIRRDKLPGDL
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgactcgttcacaactcgaggtcgacggtcgtcggatcgcgctctccaacctcgagaag
gtgctgtacccggagaccggcacccgcaagttcgacgtcgtcgactactgcatccgcatc
gccgacgcgatgctgccgcacttggcgtcgcggcccgtgacccgcaaacggtggccgggc
ggcaccgagtcggcacccttcttcgagaagaccctgcccgcggggacacccgagtggatc
gcgcggttcaccatcgagcactccgaacgcaagaccggctaccccgtggtccggtcggcg
gccgacctggtgtggctggcgcaggtcgcggccctggaactgcatgtcccgcagtggcgg
atcgacctgtcggacgacatcgaccgccgcaccgaccggatcgtgctggacctcgacccg
ggacccgacgtgagtctcgacgaatgcgcgcgcgtggccgtcgacatccgcgatctgctc
gacgacgcggggctgtcgtcgttcccggtcaccagcggcagcaaggggattcacgtgtac
gcgcggctctcgacgctggtgaagtccgagtcggcgcgggccgtcgcgaagcagatcgcg
actgcgatggcgcaggccgcaccgaggacggtgaccgcgacgatggcgaaggcgcagcgt
gaagggcgggtgttcatcgattggagtcagaacaccgcggccaagacgaccctcgcaccg
tactcgctgcgcgggcagccgagaccgtacgccgcggctccgcggacgtgggacgagctc
gccgaaccaggactgtcgcagcttgagttcaccgaggtgctggaccgctacgacgaggtc
ggcgatctcctcgcgggcttgtcgggcgaggtcgccgcagtcgcggtcgaccacgcggca
ggcggtagcgacgtcatcgatctcggcgagtaccgaaagaagaagtcgtcgcgccgggcg
tcgtcgaagccgacacccgcgccgcctggtcccaccgaacggcagcccattccctccgga
ctgacggaactgcggccgatgctggccaccgacgatccgatcgacggcctggacgacgac
tgggcctacgagggcaagtgggacggcttccgcgcgctggtccgggtggtgggtggtcgc
gcccggttgatctcgcggtcgggcaacgacctgaccggcgacttccccgagctctcggtg
atcgccgactgcctggtccgcgacgggaagccggtcgacgccgtgctcgacggcgagatc
gtcgcgctcaacgccgcgggcatctccgacttctcactcctcgtctcccgcaagcgcacg
tcggaaccgtacgagctccgcctgcacctgttcgacgtcctctatctcgacggcgtggac
ctgaccgagcagccgtgggaggtgcggcgcgagatcctcgacgcgctgacctacttcgac
ggcgagtccgtcatcgacatcccgcccctgctgcccggccccgccgaaaccgccgtcgcc
gtcgcccgggaacgtggatgggagggcgtcgtcgcgaaacggcgtgcggcccggtacgtc
agcggccgccgcagcccggactggcggaagcagaagaactggaacagcgtcgaagtggtg
atcggcggctatcgtcccggccgaggatcggagtcgaagatcggatcactgctggtgggg
gtgcccgccgaacgcggactgcggtacctgggccgagtcggcaccgggttcaccgatgcc
gaactcgacgccctgttggaggagttgcggccgctccggatcagcatgtgcccgttcgtg
gacgacatcgacaagcccgtcgcaggcagtgccacctgggtgctgccgaaactcgtcgcc
gacgtcgccttcatggactggacgtccaccgggcacctgcggcaccccacgtggcgcgga
atccggcgcgacaaactgccgggtgatctgtag

DBGET integrated database retrieval system