KEGG   Gamma proteobacterium HdN1: HDN1F_02020Help
Entry
HDN1F_02020       CDS       T01300                                 

Definition
(GenBank) Putative glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HDN1F_02020
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HDN1F_02020
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HDN1F_02020
   00430 Taurine and hypotaurine metabolism
    HDN1F_02020
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    HDN1F_02020
Enzymes [BR:gpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     HDN1F_02020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
260893..262569
Genome map
AA seq 558 aa AA seqDB search
MHQDKRPATQRFAEANMDAMYRIFTVPEAPGSTLGQIDNMISQNLMGFLQNHIVAVEKDL
SEVEKDFADAHIPEKPWFVSDQTQFLLDKLVAQSVHTASPSFVGHMTSALPYFMLPLSRI
MMALNQNLVKIETSKAFTPLERQVLGMMHRLIYERDDKFYDQWMHKSGHSLGVLCSGGTI
ANMTALWVARNAMFKPSKGFKGINHTGVFGALKHHGLEGMAVLVSERGHYSLAKAADVLG
IGRDHLLTVRTDDNNKVNIRKMRQKLEECRSRNIGVMAIVGVCGTSETGTVDPLNDLADL
AEEFGCHYHVDAAWGGATLFSQKYSHILEGIRRADSVTIDGHKQLYVPMGAGMVFFKNPT
ALSNIQHHAEYIIRQGSKDLGSHTLEGSRPGMAMLVHSGLRIIGRSGYEILINEGIEKAR
AFADMVRAEPDFEMITEPELNILTYRYVPEFVKKKLATANAREIDHIHDLLNRLTKLIQK
TQRARGKSFVSRTRLTPEKYGHRLTVVFRVVLANPLTNHQILRGVLEEQRTIASLEDCQQ
LLRQLSEACAEARHVSNG
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaggataaacgcccggctacgcaacgctttgcggaagccaatatggatgccatg
tacaggatttttacggttcctgaagcgccgggttcgaccttgggccagattgacaatatg
atcagtcagaacctgatgggctttctgcagaaccacatcgtcgcggttgaaaaggacctc
tcggaagtcgaaaaagacttcgcagacgcccacattcccgaaaaaccttggtttgtgtcc
gatcaaacccagtttttgttggacaaactggttgcgcagtcggtgcacaccgcatcgccg
agttttgttggacatatgacgtccgcgctgccgtatttcatgctgccgctttcgcgcatc
atgatggcgctgaaccaaaacctcgtaaaaatcgaaacctccaaggcgttcacaccgctg
gaacgtcaggtgctcggcatgatgcaccgcctgatttatgagcgtgacgacaagttttac
gatcaatggatgcacaaaagcggccactcactcggcgtgttatgttcgggtggaaccatc
gccaacatgacggcactttgggtggctcgaaatgccatgttcaaaccgtcgaaaggcttc
aaaggcatcaatcataccggcgtgtttggtgcgctaaagcaccacggcctagagggaatg
gcggttctggtatcggagcgcggccattattcacttgccaaagctgccgacgtattagga
attggccgcgatcatttattaacggttcgtaccgacgataacaacaaggtcaatatccgc
aagatgcgccaaaagctcgaagaatgccgctcgcgcaatatcggcgtgatggccattgtg
ggcgtctgcggcacgtctgaaaccggcaccgtagatccgttgaatgatctggccgatctc
gctgaagaatttggctgccactaccacgtagacgcggcatggggcggcgctacgctcttc
tcccaaaaatattcccacatccttgaaggaatccgccgcgcagactcggtcaccatcgac
ggtcacaaacagctatacgtaccgatgggcgcagggatggtgttcttcaagaatccaacg
gcgctctccaacatccagcaccacgccgaatacattatccgccaaggctccaaggatttg
ggctcgcacaccctagaaggttcacgccccggtatggcgatgcttgtacattccggctta
cgaatcatcgggcgcagcggctacgaaatcctcatcaatgagggcatcgaaaaggcgcgc
gcatttgccgatatggttcgcgccgaacctgatttcgaaatgattaccgagccagaactc
aatattctgacctatcgctacgttcccgaatttgtgaagaaaaagctcgcaaccgccaac
gcacgcgaaattgatcatattcacgatctgctcaaccggctcaccaaattgatccagaaa
acccagcgcgcgcgcggaaaatcctttgtttcgcgcacccgcctaacgcctgaaaagtac
ggccaccgcttaacggtagtgttccgtgtagtgctggcgaatccgctcaccaatcaccag
attttgcgcggcgttctagaagagcaacgcacgattgcctctcttgaagactgccagcag
ctattgcgccaattgagcgaggcttgcgccgaagctcgccacgtgagcaacggttag

DBGET integrated database retrieval system