KEGG   Gibbsiella quercinecans: AWC35_23230Help
Entry
AWC35_23230       CDS       T05060                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gqu  Gibbsiella quercinecans
Brite
Enzymes [BR:gqu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AWC35_23230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ATA22012
UniProt: A0A250B7U8
LinkDB All DBs
Position
complement(5239993..5240571)
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAKNALEPHISAETLEYHYGKHHNTYVVNLNNLVKGSEFEGKSLVDIIKTA
SGGVFNNAAQVWNHTFYWHCLSPQGGGEPSGAVADAINQSFGSFAQFKEAFTKSAIGNFG
SGWTWLVKKADGSLAIVNTSNAATPLTGDDKPLLTVDVWEHAYYIDYRNARPNYLENFWA
LVNWAFVAENLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgaattacctgcattaccgtatgcaaaaaacgccctcgagccgcacatttcc
gccgaaacgctggaataccactatggcaagcaccataacacctacgtggttaacctgaac
aatttggtgaaaggcagcgagtttgaagggaaatccctggttgatatcatcaaaaccgcc
agcggcggcgtgttcaacaacgccgcacaggtatggaaccacaccttctattggcactgc
ctgtcgccacaaggcggcggtgaacctagcggcgcggtggctgatgccatcaaccaatcc
ttcggctctttcgcccagttcaaagaggcattcaccaagtctgccatcggcaacttcggt
tccggctggacctggctggtgaaaaaagcagatggtagcctggctatcgtcaacacctcc
aacgcggcaaccccgctgaccggtgacgacaaaccgctgctgaccgtggatgtgtgggaa
cacgcctactatatcgattaccgcaatgcacgccccaactacctggaaaacttctgggcg
ctggtcaactgggcatttgtggcagaaaacctggcgtaa

DBGET integrated database retrieval system