KEGG   Gossypium raimondii: 105778235Help
Entry
105778235         CDS       T04129                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gra  Gossypium raimondii
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:gra00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    105778235
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105778235
Enzymes [BR:gra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     105778235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 969 aa AA seqDB search
MATNNNNSKLEKLASIDAQLRALVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRET
VQECYELSAEYEGKSTPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYR
RRIKLKKGDFADENSATTESDIEETLKRLVVDLKKSPEEVFDALKNQTVDLVFTAHPTQS
VRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEM
RAGMSYFHETVWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTP
EVTRDVCLLARMMAANLYYSQIEDLMFELSMWRCSDELRVRADELHRSSRRDAKHYIEFW
KKVPPNEPYRVILGDVRDKLYQTRERSRQMLSHGISDIPEEETFTNIEQFLEPLELCYRS
LCSCGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLEIGSYREWS
EEQKQEWLLSELSGRRPLFGPDLPKTEEIADVLDTFSVLAELPADNFGAYIISMATAPSD
VLAVELLQRECHVKQPLRVVPLFEKLADLEAAPAALARLFSIDWYRNRINGKQEVMIGYS
DSGKDAGRLSAAWQLYKAQEELINVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPE
TIHGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAV
VATEEYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWT
QTRFHLPVWLGFGAAFKHVIQKDIKNLLMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAA
LYDKLLVSEELWSFGERLRTNFEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYITTLN
VCQAYTLKRIRDPNYNVKLRPHISKEIMESSKPADELVKLNPTSEYAPGLEDTLILTMKG
IAAGMQNTG
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atggctactaataacaataatagcaagttagagaagttggcttctattgatgcacagcta
cgtgctttggttcctgctaaagtgagtgaagatgataaactggtggagtatgatgctttg
cttttggaccggttcctcgatattcttcaagacttacacggcgaggatcttagggaaacg
gttcaagaatgttatgaactttctgctgagtatgaagggaagagtacccccaagaaactt
gaggagctggggaatgttttgactagtttggatccaggggactccattgttatagctaag
gctttctcccacatgcttaacttggctaacttggctgaggaagttcagattgcttaccgg
cgaaggatcaagttgaagaaaggtgattttgccgatgagaactctgcaacaactgaatcg
gatatcgaagaaactctcaagagacttgtggttgatctcaagaagtctcctgaggaagtt
tttgatgcacttaagaaccagactgtggatctggtcttcactgctcatcctacccaatct
gttcgtagatctttacttcagaagcacggaaggataaggaactgtttagctcagttgtat
gctaaagatattactccagatgataagcaggagcttgatgaagctctacagcgtgagatt
caagccgcatttcgtacagatgagattcgaaggactcctccaactccccaagatgagatg
agggcgggaatgagctacttccatgaaacggtatggaaaggtgtccccaaattcttgcgg
agagttgacacagctttgaagaatattggaattaatgaacgtgttccctataatgcgcca
cttattcagttttcttcatggatgggtggtgatcgtgatggcaatccaagggtaactcct
gaggtcacaagggatgtttgcttgttggctagaatgatggctgccaatttgtactattcc
caaatcgaggatctgatgtttgagttgtcaatgtggcgttgcagtgatgagcttcgtgtt
cgtgcagacgaacttcatagatcttcaaggagagatgctaaacactacatagaattctgg
aaaaaagttcctccaaatgaaccctaccgtgttattcttggtgatgttagggacaagctg
tatcagacacgtgaaaggtctcgccaaatgttgtctcatggtatctctgacattccagag
gaggaaactttcaccaacattgagcagtttttggaaccgcttgaactatgttataggtca
ctttgctcttgtggtgaccggccaattgctgatggaagtcttcttgatttcttgaggcaa
gtgtcaacttttggcctctcacttgtcagacttgacattcggcaagagtctgaccgccac
accgatgtcttagatgccatcaccaagcacttggaaattggttcctaccgagagtggtct
gaagaacaaaagcaggaatggctattgtctgaactaagtggaagacgtccattgtttggt
cctgatcttcctaaaacagaagaaattgctgatgttttggataccttcagtgtcctagca
gagctcccggcagacaactttggagcatacatcatttcaatggcaactgctccttctgat
gttcttgctgttgagctcctacagcgtgaatgccatgtgaagcaaccattaagagttgtt
ccactgtttgagaagcttgcagatctggaggctgcacctgctgctttggctcggctcttc
tctatagattggtacagaaatcggatcaatggcaagcaggaagtcatgattggttattct
gattcgggtaaagatgctggccgtctctctgctgcctggcagttatacaaagctcaagag
gagcttatcaatgttgctaagcaatttggtgtgaagctaacgatgttccatggtcgtggt
ggaactgttggaagaggtggtggtcccacccaccttgctatattatctcaaccaccagaa
acaattcacggctcacttcgggttacagttcaaggtgaagttattgagcaatcgttcgga
gaggaacacttgtgctttagaacactccagcgttttactgctgccacacttgagcatggc
atgcacccaccagtttcaccaaaaccagaatggcgtgcactgatggatgaaatggctgtc
gttgctactgaggagtaccgttccattgtcttcaaagaacctcgatttgttgaatatttc
cgccttgctacaccagagttggagtatggtagaatgaatattggaagccgaccatcaaag
cggaagccaagtgggggtatcgaatctcttcgtgcaatcccatggatctttgcgtggacg
cagacgagattccatctccctgtttggctcggatttggagctgcatttaaacatgtcatt
cagaaggacattaagaatctccttatgctgcaggagatgtacaatgaatggcctttcttc
agagtgacaattgatttggttgaaatggtctttgcaaaaggagatcctgggattgcagcc
ttatacgataagcttcttgtttctgaggaactctggtcttttggagagcggttgagaacc
aactttgaagaaactaaaagccttctcctccagattgctgggcacaaggatcttctcgaa
ggggatccctacctgaagcaaagactccggctacgtgattcatacatcaccactctaaat
gtctgccaggcctacacactcaaacgtatccgtgacccaaattacaatgtgaagttgcgg
ccacatatctctaaagagatcatggaatcaagcaaacctgctgatgaacttgtgaaactg
aacccaacaagcgagtatgcccctggtttggaggacaccctcatcttgaccatgaagggt
attgctgccggcatgcaaaacaccggttaa

DBGET integrated database retrieval system