KEGG   Gramella sp. LPB0144: LPB144_11365Help
Entry
LPB144_11365      CDS       T04586                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
grl  Gramella sp. LPB0144
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:grl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LPB144_11365
  Amino acid metabolism
   00310 Lysine degradation
    LPB144_11365
   00380 Tryptophan metabolism
    LPB144_11365
Enzymes [BR:grl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     LPB144_11365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2527213..2529990
Genome map
AA seq 925 aa AA seqDB search
MDRFSFLNAAHTAYFAELYDQYLQNPDSVEPSWRAFFQGFDFGMQQDGVSQELLNNEAPV
NFAEGEIPEQVVKEFQVIRLIDGYRTRGHLFTKTNPVRERRKYRPTLDISNFGLEESDLK
TTFSAGDILGIGPSPLQEIIKHLEKVYCESIGIEYMYIRKPEEIQWIQDKLNVNDNQPQF
DEKGKKQILKKLNEAVSFESFLHTKYVGQKRFSLEGNESLIPALDSLIEKAAELGVKDFV
MGMAHRGRLNTLTNIFGKSAKDIFSEFDGKDYEQDIFDGDVKYHLGWTSCRTTDNGNEIN
INIAPNPSHLETVGPVVQGIARAKQDRRYNGDNSKVLPILVHGDAAIAGQGLVYEIVQMA
QLEGYQTGGTIHIVVNNQIGFTTNYLDARSSTYCTDVGKVTLSPVLHVNADDAEAVVHAM
LFALDFRMKFKRDVFIDLLGYRKYGHNEGDEPRFTQPKLYKAIAKHKNARDIYAEQLMQS
GLIDESYIKKLEEEYKATLEEELEDSRKEETTKITPFMEDEWEGFENGVEDDMMKDVDTT
FDLKKLDKVAEAVSQLPEGKKFMRKIKKIIDGRKKMYFEDNKLDWSMAEHLAYGSLMTEG
YNIRISGQDSERGTFSHRHAVVKVEESEEEIILHNNIENRDGDFFIYNSPLSEYGVVGFD
YGYAMASPTTLNIWEAQFGDFVNGAQIMIDQYISAAEDKWKLQNGLVMFLPHGYEGQGAE
HSSGRMERFLQLCAKDNMFVADISTPANMFHLLRRQMKAEFRKPLIIFTPKSLLRHPKVI
STKEEFANGGFQTVLDDPDANADNVKTLVFCTGKFYYDLLKHKEENNRDDVALVRIEQLF
PLPTSKMREMMDKYKNADDVVWAQEEPRNMGAYGHFLLHFEEARQFRVCSRKFYGSPAAG
SAVRFKKRHERVIASVFDKDLKEEN
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggatagattttcatttctaaatgctgctcatactgcttatttcgcagaactttacgat
caatacttacagaaccctgatagcgtagagcccagttggagggctttttttcaaggcttt
gactttggaatgcaacaggacggggtttctcaggaactattgaacaacgaagctcccgtg
aattttgcagaaggggagataccagaacaggttgtaaaagaatttcaggtaatacgatta
attgacggttaccgtacccgagggcatttattcactaagacaaacccggtaagggaaaga
agaaaatacaggccaactctcgatatttccaattttggactcgaagaaagcgacctgaaa
accacatttagcgcaggagacatactgggaattggaccttcccctcttcaggaaattatt
aaacatcttgaaaaggtttactgcgaatctattggtatcgagtatatgtatattcgtaag
ccggaagagattcagtggattcaggataagctgaatgttaatgataatcagccgcaattc
gacgaaaaagggaaaaaacagatcctgaaaaaactcaatgaggccgtttcttttgaatcc
tttttgcataccaaatatgtggggcaaaagagattttcactggaaggtaacgaaagcctt
attccggcgctagactcgctaatagaaaaagcggccgaacttggagtgaaggattttgta
atgggaatggctcaccgtggtagacttaatacgcttaccaacatcttcgggaaaagtgct
aaagacatcttcagcgaatttgacggtaaagattatgaacaggatatttttgacggtgac
gtaaaatatcaccttggctggacttcatgtcgtactaccgataacggtaacgaaataaat
ataaacatagcgccaaatccatctcaccttgagactgtaggaccggtagttcagggtatt
gcccgggctaaacaggaccgcagatataatggggataactccaaggtgcttccaattctt
gttcatggtgatgcagctattgctggacagggattagtttatgaaattgtacaaatggct
cagctggaaggttatcaaaccggcggaaccatacatatagtggtaaataaccagattggt
tttactacaaattatcttgatgcaagaagctcaacatactgtacagatgtagggaaagtt
actctttctccggtacttcacgtaaatgcagacgatgcagaagctgtggtgcacgctatg
cttttcgcactggacttcagaatgaaatttaaaagggatgtgtttatagaccttcttggc
tatagaaaatatggtcataatgaaggggatgaaccaagatttacacagcctaagctttac
aaggcgattgccaagcataaaaatgctcgcgatatttatgcagagcaattaatgcaaagc
ggacttatagacgaatcctatattaaaaagcttgaggaggaatataaagcaactcttgaa
gaggagcttgaggactccagaaaagaagagactaccaagattactccgttcatggaagat
gaatgggaaggatttgagaatggggtagaggatgacatgatgaaagatgttgatactacc
ttcgatcttaaaaaactggataaggtagccgaagctgtttctcaattgccggagggcaag
aagtttatgagaaagatcaaaaagatcatagacgggagaaagaaaatgtattttgaagat
aataagctggattggtctatggccgagcatttagcttacggatctttaatgacagagggt
tataatatcagaattagcggtcaggatagtgaaagaggaacattctctcaccgtcatgcc
gtggtaaaagttgaagaaagtgaagaagagatcattcttcataataatatagagaacaga
gacggagatttcttcatttataactctccgctttcagaatatggagttgtaggctttgat
tatggttatgccatggcaagcccaacaacacttaatatctgggaagcgcaatttggggat
ttcgtgaatggagctcagatcatgatagatcagtatatctctgcagcagaggataaatgg
aagcttcagaatggacttgtgatgttccttcctcatggatatgagggtcagggagcggag
cactcttccggtagaatggagcgtttccttcagttatgtgctaaggacaatatgtttgtg
gcagatatttccactcctgcgaatatgttccaccttttaagaagacagatgaaggcagaa
tttagaaagccccttatcatctttactcctaaaagtttattgagacatccaaaagtgatc
tctaccaaagaggaattcgcgaatggtggtttccagaccgttcttgacgatccggatgca
aatgcagataatgtgaaaactctggtattctgtactggtaagttctattacgacctgtta
aagcataaggaagagaataacagggatgatgtggctcttgtgcgtattgaacaactattc
ccattacctacttccaaaatgagggagatgatggataaatataagaatgcagacgatgtg
gtttgggcacaggaagaacctcgaaatatgggggcttatggtcacttcttactgcatttt
gaagaagcgcgtcaattcagggtttgtagccgtaagttttacggttcacctgctgccggt
agtgcagtgcgtttcaagaaacgtcacgaacgcgtgatcgccagtgtatttgataaagat
ctaaaagaagaaaattaa

DBGET integrated database retrieval system