KEGG   Geobacter sulfurreducens KN400: KN400_1135Help
Entry
KN400_1135        CDS       T01940                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, iron/manganese-containing
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gsk  Geobacter sulfurreducens KN400
Brite
Enzymes [BR:gsk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KN400_1135 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1234375..1234953
Genome map
AA seq 192 aa AA seqDB search
MAYEAKDYSKLIGMAGFSEALLKNHFTLYQGYVTNTNKVLDILAKMLADGATATPEYAEL
KRRLGWEFNGMRLHEFYFENLGGNGAIDQAGKLAAKIVADFGSYEAWEKDFRATGAMRGI
GWAVLYQDSATGKLINFWVNEHDVAHPAGCTPILIMDVFEHAFMLDYGLKRPDYIEAFFK
NIDWKAAEARLK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaagcaaaagactattcgaaactgatcgggatggcgggattcagcgaggct
ctcctgaagaaccatttcaccctttatcagggttatgtgaccaatacgaacaaggtgctc
gacatcctcgccaaaatgctcgccgacggtgccactgccactcccgagtatgcggagctg
aagcggcgcctgggatgggagttcaacggcatgcggctccacgagttctatttcgagaat
ctcggcggcaacggtgccatcgaccaggccggcaagctggccgcgaaaattgttgccgac
ttcggcagctatgaggcgtgggagaaggatttccgggccaccggcgccatgcggggtatc
ggctgggcagtgctctaccaggattcggccaccggcaagctcattaacttctgggtcaac
gagcacgacgttgctcatccggccggctgcactcccatcctgatcatggatgtcttcgag
catgcctttatgctcgattacggtctcaagcgtcccgactacatcgaggccttcttcaag
aatatcgactggaaggccgccgaggcacggttgaaataa

DBGET integrated database retrieval system