KEGG   Geobacillus subterraneus: GS3922_01635Help
Entry
GS3922_01635      CDS       T04323                                 

Definition
(GenBank) transglutaminase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
gsr  Geobacillus subterraneus
Brite
Enzymes [BR:gsr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     GS3922_01635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(350471..351289)
Genome map
AA seq 272 aa AA seqDB search
MIRILASPSGLSPSYSSSLSKNEQAILNALVSSPVLYTYPNERQLRFEIALRAHTVQAAV
DLAKSRARFAIFRFSRCNGQFWERDERGGFRLRPGVPASEAINDIFINSELYAFECATAI
VIVFYKAVLDTIDVAAFNRLFANLLLYDWHTDRDLGIHTKKGEHFLPGDCLYFKNPEFDP
STPQWQGENTIYLGDGLFYGHGIGIQTEDGIIAALNRKRKRGATKSAYLLPHITQVNFTY
LSQFARPLNEFRLPLRPSFIAGTLGSATFLYR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgatccgcattttagcttcaccgtccggtttgagcccgtcttactcgtcttccctttcg
aaaaacgagcaggcgatcctaaacgctcttgtttcttcgcctgtgctgtacacatatcca
aatgaacgacaactgcgatttgaaattgcgttgcgcgcccacaccgtccaagctgcggtc
gacttagcgaagagccgggcgcggtttgccatttttcgtttttcgcgctgcaacggccag
ttttgggagcgggacgagcgaggcggttttcggctgcggccgggcgtccctgcttcggaa
gccattaacgacattttcattaatagcgaactgtacgcctttgagtgtgcgacggccatt
gtcatcgtcttttataaagcggtgctcgacacgattgacgtcgcagcgttcaaccgcctg
ttcgccaatttgcttttgtacgactggcataccgaccgagatcttggcatccatacaaaa
aagggagaacatttcctccccggggactgcctctattttaaaaacccggaattcgacccg
tcgacgccgcaatggcagggggaaaatacgatttacttaggcgacggcttgttttacggg
catggcatcggcattcaaacagaagacggcatcattgccgcccttaatcggaagcgtaaa
cggggggcgacgaaatccgcctatcttctcccccatattacgcaagtcaacttcacgtat
ttgtcccaattcgcccgcccgttgaacgaattccgcttgccgctccgcccatcgttcatc
gccgggacgttagggtccgctactttcttgtatcgttag

DBGET integrated database retrieval system