Gavia stellata (red-throated loon): 104254756 Help Entry 104254756         CDS       T08384                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism gste  Gavia stellata (red-throated loon) Pathway gste04010   MAPK signaling pathway gste04012   ErbB signaling pathway gste04068   FoxO signaling pathway gste04137   Mitophagy - animal gste04140   Autophagy - animal gste04144   Endocytosis gste04150   mTOR signaling pathway gste04210   Apoptosis gste04218   Cellular senescence gste04370   VEGF signaling pathway gste04371   Apelin signaling pathway gste04510   Focal adhesion gste04540   Gap junction gste04625   C-type lectin receptor signaling pathway gste04810   Regulation of actin cytoskeleton gste04910   Insulin signaling pathway gste04912   GnRH signaling pathway gste04916   Melanogenesis gste05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gste00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104254756 (HRAS)    04012 ErbB signaling pathway     104254756 (HRAS)    04370 VEGF signaling pathway     104254756 (HRAS)    04371 Apelin signaling pathway     104254756 (HRAS)    04068 FoxO signaling pathway     104254756 (HRAS)    04150 mTOR signaling pathway     104254756 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104254756 (HRAS)    04140 Autophagy - animal     104254756 (HRAS)    04137 Mitophagy - animal     104254756 (HRAS)   09143 Cell growth and death    04210 Apoptosis     104254756 (HRAS)    04218 Cellular senescence     104254756 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104254756 (HRAS)    04540 Gap junction     104254756 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104254756 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104254756 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104254756 (HRAS)    04912 GnRH signaling pathway     104254756 (HRAS)    04916 Melanogenesis     104254756 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104254756 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gste04131]     104254756 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gste04147]     104254756 (HRAS)    04031 GTP-binding proteins [BR:gste04031]     104254756 (HRAS) Membrane trafficking [BR:gste04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104254756 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104254756 (HRAS) Exosome [BR:gste04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104254756 (HRAS)   Exosomal proteins of colorectal cancer cells    104254756 (HRAS) GTP-binding proteins [BR:gste04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104254756 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  104254756 NCBI-ProteinID:  XP_009806917 UniProt:  A0A093H8W5 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataagctggtggtggtgggagctggtggtgtcgggaagagcgctttgacg atacagctcattcagaaccatttcgttgatgagtatgaccccacgatagaggattcctac agaaagcaagtcgtcatcgatggcgagacctgcttgttagacatcttggataccgcaggg caagaggagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctctgc gtcttcgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcggatgatgttcccatggtgctggtgggaaataaatgtgaccta ccagcccggacagtggagacccggcaagcgcaggacctggcccggagttacgggatcccc tacatagaaacgtctgccaaaaccagacagggcgttgaagatgccttctacaccttggtg cgggagatccgtcagcataagctgcgcaagctgaatcccccagatgagagcggccccggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system