KEGG   Geobacter sulfurreducens PCA: GSU1158Help
Entry
GSU1158           CDS       T00155                                 

Gene name
sodA
Definition
(RefSeq) superoxide dismutase, iron/manganese-containing
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gsu  Geobacter sulfurreducens PCA
Brite
Enzymes [BR:gsu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GSU1158 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1263493..1264071
Genome map
AA seq 192 aa AA seqDB search
MAYEAKDYSKLIGMAGFSEALLKNHFTLYQGYVTNTNKVLDILAKMLADGATATPEYAEL
KRRLGWEFNGMRLHEFYFENLGGNGAIDQAGKLAAKIVADFGSYEAWEKDFRATGAMRGI
GWAVLYQDSATGKLINFWVNEHDVAHPAGCTPILIMDVFEHAFMLDYGLKRPDYIEAFFK
NIDWKAAEARLK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaagcaaaagactattcgaaactgatcgggatggcgggattcagcgaggct
ctcctgaagaaccatttcaccctttatcagggttatgtgaccaatacgaacaaggtgctc
gacatcctcgccaaaatgctcgccgacggtgccactgccactcccgagtatgcggagctg
aagcggcgcctgggatgggagttcaacggcatgcggctccacgagttctatttcgagaat
ctcggcggcaacggtgccatcgaccaggccggcaagctggccgcgaaaattgttgccgac
ttcggcagctatgaggcgtgggagaaggatttccgggccaccggcgccatgcggggtatc
ggctgggcagtgctctaccaggattcggccaccggcaagctcattaacttctgggtcaac
gagcacgacgttgctcatccggccggctgcactcccatcctgatcatggatgtcttcgag
catgcctttatgctcgattacggtctcaagcgtcccgactacatcgaggccttcttcaag
aatatcgactggaaggccgccgaggcacggttgaaataa

DBGET integrated database retrieval system