KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0903Help
Entry
Geoth_0903        CDS       T01531                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00020  Citrate cycle (TCA cycle)
gth00480  Glutathione metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
gth01200  Carbon metabolism
gth01210  2-Oxocarboxylic acid metabolism
gth01230  Biosynthesis of amino acids
Module
gth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gth_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Geoth_0903
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Geoth_0903
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Geoth_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEH46901
LinkDB All DBs
Position
877948..879222
Genome map
AA seq 424 aa AA seqDB search
MVTQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWK
EVLAGEKAYKQTGEWLPQETLDVIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCL
RPVRYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKI
RFPETSGIGIKPISEQGTKRLVRAAIKYAIDHGRKSVTLVHKGNIMKFTEGAFKNWGYEL
AEEEFSDKVFTWAQYDRIVETEGKEAANKALAEAEEAGKIIIKDVIADIFLQQILTRPRE
FDVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNP
SSVILSGVMMFEHLGWNEAAKLIVDALEKTIASKIVTYDFARLMEGATEVKCSEFADAII
RNME
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgcaaggggaaaaaattacagtaacgaatggtgtgttaaacgtaccaaacaat
ccgattattccatttattgaaggagacgggacaggaccggacatttgggcggcggcatcc
cgcgtgttagaagctgcggtcgaaaaggcgtataaaggcgaaaagaaaatcgtttggaaa
gaagtgcttgcgggtgaaaaagcgtacaagcaaaccggcgagtggcttccacaagaaacg
cttgatgtgattcgtgaatacataattgctattaaaggtccattaacgactccggtcggc
ggcggcatccgttcattgaacgtagcgctgcgccaagaattggacttattcgtttgcttg
cgccctgtccgctattttaaaggtgttccttctccggtgaaacgccctgaagatacggac
atggtcattttccgtgaaaacacggaagacatttacgcaggaattgagtatgcaaaagga
acgccagaagtgaaaaaagtgattgatttcttgcaaaatgaaatgggcgttcgcaaaatc
cgcttcccagaaacgtctggtatcggcattaagccaatttctgagcaaggaacgaagcgg
ttagtgcgcgccgctatcaagtatgcgattgatcatggacgaaaatcggtgacgcttgtt
cataaaggaaatattatgaaattcacagaaggcgcatttaaaaattggggctatgaatta
gcggaagaagaatttagcgataaagtatttacatgggcacaatatgaccgcattgtcgaa
acagaaggaaaagaagcggcgaataaagcgctggcggaagcagaagaagctggaaaaatt
attatcaaagacgtcattgccgatattttcttgcaacaaattttgacgcgcccgcgtgag
ttcgatgttgtggcgacaatgaacttaaacggcgactacatttctgacgcgctggcagcg
caagtcggcggcattggtatcgctccgggagcgaacattaactacgaaacaggacatgcg
atttttgaggctactcatggaacggctccgaaatatgctggcttggacaaagtgaatccg
tcatctgtcattttgtccggtgtaatgatgtttgaacatctcggctggaacgaagcggca
aagcttatcgtcgatgcgctggaaaaaacgattgcttccaaaatcgtcacatacgatttt
gcccgtctgatggaaggcgctactgaagtgaaatgctccgaattcgctgacgcaatcatc
cgcaatatggaataa

DBGET integrated database retrieval system