KEGG   Parageobacillus thermoglucosidasius: Geoth_1381Help
Entry
Geoth_1381        CDS       T01531                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gth  Parageobacillus thermoglucosidasius
Brite
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Geoth_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1315577..1316488
Genome map
AA seq 303 aa AA seqDB search
MSEQELFQRYVKQVSEWGAQVGQMLPRRDDGTVHHDIAALLSYIDRHDGEWTETEIYDLQ
RMADAVYEKAAAVSANGTLADESRETSEEEARRQTYITAGRHVLPPLPYSYDALEPHISK
EIMQLHHTKHHQSYVDGLNKAEKMMKKARETNNYELLKHWEREAAFHGSGHYLHTIFWSN
MHPKGGGEPHGELLEQIKRDFGSFERFKRHFTEAAKSVEGVGWALLVWSPRSHRLEILQT
EKHQLMTQWDTIPLLVLDVWEHAYYLQYKNDRAAYINSWWNIVHWRDVEERFAQARKLRW
KPF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaagagttatttcagcgatatgtgaaacaagtcagcgaatggggcgcgcaa
gtcggacaaatgctaccgcgaagggatgatggcacggtccatcacgacattgcggcattg
ctttcctacatcgacaggcatgacggggaatggacggaaacggaaatttatgatctccag
cgcatggccgatgcagtgtatgaaaaagcagcagcggtttcggcaaacgggacattggct
gacgaaagtagagaaaccagcgaggaagaagcgcggcgccaaacctatataacagcgggc
aggcacgttcttccgccgcttccgtacagttatgacgcgcttgagccgcatatttccaaa
gaaataatgcaactgcatcatacgaaacaccatcaaagttatgtggacggattgaataaa
gcggaaaaaatgatgaaaaaagcgcgcgaaacaaataactatgaattgctgaagcactgg
gagcgggaagcagcgtttcacggttccgggcattatttgcataccattttttggagcaat
atgcatccaaaaggaggaggagagccgcacggcgagctgctggaacaaataaagcgcgat
ttcggaagttttgaacggtttaagcgtcattttaccgaggcggcaaaaagcgtcgaagga
gttggctgggcgctgctcgtttggtcgccgcggtcgcaccgcttagaaattttgcagacg
gaaaaacatcaacttatgacgcagtgggatacgattccgcttcttgtcttagacgtttgg
gaacatgcctattatttgcaatataaaaacgaccgtgctgcgtatattaacagctggtgg
aatatcgtccattggcgcgatgtggaagagcggtttgcccaagcgcgcaagctgcgttgg
aaaccgttttga

DBGET integrated database retrieval system