KEGG   Geobacillus thermocatenulatus: GT3921_07185Help
Entry
GT3921_07185      CDS       T05178                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gtm  Geobacillus thermocatenulatus
Brite
Enzymes [BR:gtm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GT3921_07185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N AHSP
Motif
Other DBs
NCBI-ProteinID: ASS98847
UniProt: A0A1V9CSZ2
LinkDB All DBs
Position
1453651..1454265
Genome map
AA seq 204 aa AA seqDB search
MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN
LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELAEAINKKFGSFTAFKDEFS
KAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRPE
YIAAFWNIVNWDEVAKRYSEAKAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgaattgccagcattgccgtatccgtacgatgccctggagccgcacatcgac
aaggaaacgatgaacattcaccacacgaagcaccataacacatacgttacaaatttgaat
gcggcgcttgaagggcatccggatttgcaaaacaaatcgctcgaagaattgctcagcaat
ttggaagcccttccggaaagcattcgcacggcggtgcgcaacaacggcggcggccatgcg
aaccactcgcttttctggacgattttgtcgccaaatggcggcggtgagccgacgggtgag
ctggctgaggcgatcaacaaaaaattcggcagcttcaccgcgtttaaagacgagttttcg
aaagcagcggctggccgtttcggttctggctgggcatggcttgtcgtgaacaacggcgag
ctggaaattacgagcacgccgaaccaagattcgccgattatggaaggcaaaacgccgatt
ctcggcttggacgtttgggagcatgcgtactacttgaaataccaaaaccgccgtccggaa
tacattgccgcattctggaacattgtcaactgggacgaagtggcgaaacggtacagcgaa
gcgaaagcgaagtaa

DBGET integrated database retrieval system