KEGG   Geobacter uraniireducens: Gura_1053Help
Entry
Gura_1053         CDS       T00521                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
gur  Geobacter uraniireducens
Brite
Translation factors [BR:gur03012]
 Eukaryotic Type
  Elongation factors
   Gura_1053
 Prokaryotic Type
   Gura_1053
Mitochondrial biogenesis [BR:gur03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Gura_1053
Exosome [BR:gur04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Gura_1053
  Exosomal proteins of breast cancer cells
   Gura_1053
  Exosomal proteins of colorectal cancer cells
   Gura_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1255557..1256747
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLAGKGQAEFKAFDQIDNAPEERERG
ITIATAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDEELLELVELEIRELLSSYDFPGDDIPIIKGSALKALE
GDTGELGEQAIMKLMEAVDSYIPEPVRAIDKPFLMPVEDVFSISGRGTVATGRVERGIVK
VGEEVEIVGMKATAKTTVTGVEMFRKLLDEGRAGDNIGALLRGVKREDIERGQVLAKPGS
ITPHTKFKAEAYILTKEEGGRHTPFFNGYRPQFYFRTTDVTGIVELAAGTEMVMPGDNVA
VTVNLITPIAMDEGLRFAIREGGRTVGAGVVSSIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagcaaaattcgagagaacaaaaccgcatgtaaacatagggacgatcggtcac
gttgaccacggcaagacgacattgaccgcagccatcaccaaagtgttggccggaaaaggt
caggccgaattcaaagcattcgatcagatcgataatgcaccagaagagcgtgagcgtggt
atcaccatcgcaaccgcccatgtggaatatgaaaccgacaagcgtcactacgcccacgtc
gactgcccgggccatgccgactacgtcaagaacatgatcaccggcgcagcccagatggac
ggcgcaatcctggttgtgtccgcagccgacggcccgatgccgcagacccgtgagcacatc
ctgctggcccgtcaggtaggcgtaccatacatcgtcgtattcctcaacaaagccgacatg
gtagatgatgaagaactcctcgaactcgtcgagctggaaatccgtgaactgctctcatcc
tacgacttccccggcgatgacattcccatcatcaaaggctccgccctcaaggccctcgaa
ggagacaccggcgaactgggcgagcaggcaatcatgaagctcatggaagccgtcgacagc
tacatccccgagccggtacgcgccatcgacaagccgtttctcatgcccgtcgaagacgta
ttctccatctccggccgcggcaccgtagcaaccggccgtgtcgagagaggaattgtaaaa
gtaggcgaagaagtagaaatcgtcggcatgaaggcaaccgccaagaccaccgtaaccgga
gtcgagatgttcagaaagctgctcgacgaaggccgtgcaggcgacaacatcggcgccctg
ctgcgcggcgtcaagcgagaagacatcgagcgtgggcaggtacttgcaaagccgggctcc
attaccccgcacaccaagttcaaagcagaagcctacatcctgaccaaagaagaaggcgga
cgtcacaccccgttcttcaatggctaccgcccgcagttctacttccgcaccaccgacgta
accggcatcgtagaactcgccgccgggaccgagatggtaatgcccggagacaatgtagcc
gtaacagtaaacctgatcaccccgattgccatggacgaaggactgcgattcgccattcgt
gaaggcggccgtaccgttggcgcaggtgtcgtcagctctattatcgaataa

DBGET integrated database retrieval system