KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20155Help
Entry
HMPREF0421_20155  CDS       T01344                                 

Gene name
ppc
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF0421_20155 (ppc)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0421_20155 (ppc)
Enzymes [BR:gvg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HMPREF0421_20155 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
172274..175030
Genome map
AA seq 918 aa AA seqDB search
MTTQNQQVTPADATIVTSGLGRKGPEERELPASLKQDMDLCLHILRDVLGEFDEKLLTVF
DEVRLNAVNASTAHFAQMVDAQGTEDDGLNKAVEKINGMDLPDMQLLARAFATYFHLANL
CEENYRVSVLHQRECEVEESNPVDPVNELTCAYHKLLTEMSPAQAKELLNKLEFHPVFTA
HPTEARRKAVAGKIRRISKLLSKHNRLGGSDKRENYRRLYNEIDALLRTSPIALKKPTPV
EEADTILDIFDATLFNTIPLVYRRFDDWLLGKKAGLVPPRCPAFFHPGSWIGSDRDGNPN
VTAKVSRQVASKFSNHVLKALEERTREVGKCLTMETRTTPPSVELLELWNRQREMSEQLT
ENASDVSNSEPHRAVMLVMADRLHHTISRNTDLMYHSCEEFIEDLRIVQRSLAEAGDARA
AYGPLQDLIWQAQTFGFHMVEMEFRQHSLVHSRALEDIREHGLHGERGPLQPMTREVLDT
FRALGAIQKRNGMRAARRYIISFAKSAQHVRDVFELNRLAFAHPQDAPTIDVIPLFEQLE
DLQNSVNVLEEIIKIPEVQARLKATGRKMEVMLGYSDSSKDAGPTSATLALHSAQERIAQ
WAKDHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVNCRFKLTEQGEVIFARYGNPIL
AIRHLESVAAATLLQSAPSVEKTNTEMTHKYADMAQKLDVAAHNRFIDLLQTDDFTPWFS
TVTPLSEIGLLPIGSRPAKRGLGAKSLDDLRTIPWVFSWAQARINLAAWYGLGTACEKFG
DLETLRRAYEEWPLFSTFIDNIEMSLAKTDERIARMYLSLGDREDLSDKVLSEMQLTRKW
VLQIVGDKWPLQHRHVLGQAIRVRSPYVDALSVIQSLALHKLRNKVDKEELSESQQAEFI
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaaaatcaacaggtgactccagcagacgcaacaatagttacgtctggacta
ggacgaaaaggacctgaagagcgcgaactgccagcatcgcttaagcaagacatggattta
tgcttacatattctgcgcgatgtattaggcgaatttgatgaaaaactattaaccgtattc
gacgaagtgcgattaaacgcggtaaacgcaagcacagcacacttcgcacaaatggttgat
gcacaaggaacagaagacgacgggctaaacaaagctgtagaaaaaatcaacggcatggat
ttgccagatatgcagcttcttgcgcgtgcgtttgctacatacttccacttagcaaacctg
tgcgaagaaaactacagggtctccgtgctgcaccaacgcgaatgcgaagtagaagaatct
aatcccgtagacccagttaacgagctaacatgcgcataccacaagttgctcacggaaatg
agccctgcgcaagctaaggaactgctaaataaacttgaattccatccagttttcacagcg
catccaaccgaagcgagacgaaaagctgtagctggtaaaatccgcagaatatcaaagctt
ctaagcaaacacaataggctaggaggatcagacaagcgcgaaaactacaggcgtctatac
aacgagatagacgcattgctccgcacatcgcctattgctcttaaaaaaccaacaccagtt
gaagaagcagacacaatactagatatattcgacgcaacattattcaacacaattccgttg
gtttatcgcagatttgacgattggcttttgggcaaaaaagctggattagtgccaccgcgc
tgcccagcattcttccacccaggaagctggattggatccgatagagacggaaatccaaac
gttacagcaaaggtaagtaggcaggttgcgagcaagtttagcaaccacgttttgaaagcg
ctggaagaacgcacgcgcgaagttggcaaatgcctgactatggaaacacgcacaacgcct
ccaagcgttgaactgctggaactttggaaccgccagagggaaatgagcgagcagctcact
gaaaacgcgtccgacgtatctaacagcgagccgcatagagccgttatgcttgtgatggca
gatcgactacaccacacgattagccgcaatacagacttgatgtatcattcttgcgaagag
ttcattgaagatttgcggatagtgcaacgttcgcttgctgaggctggagatgctcgagca
gcatatggaccattgcaggatttgatctggcaggcgcaaacctttggattccacatggtg
gagatggagttccgtcagcattcgctcgtgcattcgcgcgcattggaagatattcgtgag
catggattacacggggagcgtggccctctgcaaccgatgactcgtgaagttcttgacact
ttccgcgctttgggagcaattcaaaagcgcaacggtatgcgtgcagctcgccgctacatt
atttcgtttgcaaagtctgctcagcatgttcgcgatgtatttgagcttaatcgccttgcg
tttgcgcatccacaggatgctccaacaattgacgtaataccactttttgagcagctagaa
gatttgcagaattcggttaatgttcttgaggaaatcattaagattccagaagttcaggct
agactgaaggctactggtcgcaagatggaagttatgctcggctactccgattcttccaaa
gacgcaggtcctacttctgcaacacttgcattacattctgctcaagaacgtattgcacag
tgggctaaagatcatgacattgatttgacactattccacggcagaggaggagctgttgga
cgaggcggtggtcctgcaaaccgtgctgttcttgctcaaccagttggttcagtaaattgc
cgatttaagcttactgaacaaggtgaggttatttttgctcgctacggaaacccaattctt
gccattcgtcacttggaatcagtagctgcagcaactttgcttcaatctgctccaagcgtt
gagaaaaccaacacggaaatgactcataagtatgcggatatggctcaaaagcttgatgtt
gcagcgcataatcgttttattgatttgcttcaaacagatgactttacgccttggttctca
accgttactccgcttagtgagattggtttgctcccaatcggatctcgccctgcaaagcgc
ggtcttggtgcaaagtctttggacgatttgcgcacaatcccgtgggttttctcttgggcg
caagctcgaatcaacttggcagcgtggtacggcttgggtacagcttgcgaaaagtttggc
gacttggaaactttgcgcagagcttacgaagaatggccgctgtttagtacttttattgac
aatattgagatgtctttggctaaaacagacgagcgaattgctcgcatgtatctaagcctt
ggagatcgcgaagatttaagcgataaagtgctttcggaaatgcagcttacgcgcaagtgg
gttttgcaaattgttggtgacaagtggccgctgcaacatcgtcatgtgcttggtcaagcg
attcgcgtgcgctcgccttacgtggacgcgctttctgtaattcagtcacttgctttgcat
aagcttcgcaacaaggtggataaggaagaattgagcgaaagccagcaagcagagttcatc
tacctgattctctgcactgtttccggtgttgctgcaggcttgcaaaacactggatga

DBGET integrated database retrieval system