KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0029Help
Entry
HMPREF9231_0029   CDS       T01939                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxykinase (GTP)
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF9231_0029 (ppc)
  Energy metabolism
   00680 Methane metabolism
    HMPREF9231_0029 (ppc)
Enzymes [BR:gvh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HMPREF9231_0029 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
33219..35975
Genome map
AA seq 918 aa AA seqDB search
MTTQNQQVTPADATIVTSGLGRKGPEERELPASLKQDMDLCLHILRDVLGEFDEKLLTVF
DEVRLNAVDASAAHFAQMVDAQGTEDDGLNKAVEKINGMDLPDMQLLARAFATYFHLANL
CEENYRVSVLHQRECEVEESNPVDPVNELTCAYHKLLTEMSPAQAKELLNKLEFHPVFTA
HPTEARRKAVAGKIRRISKLLSKHNRLGGSDKRENYRRLYNEIDALLRTSPIALKKPTPV
EEADTILDIFDATLFNTIPLVYRRFDDWLLGKKAGLVPPRCPAFFHPGSWIGSDRDGNPN
VTAKVSRQVASKFSNHVLKALEERTREVGKCLTMETRTTPPSVELLELWNRQREMSEQLT
ENASDVSNSEPHRAVMLVMADRLHHTISRNTDLMYHSCEEFIEDLRIVQRSLAEAGDARA
AYGPLQDLIWQAQTFGFHMVEMEFRQHSLVHSRALEDIREHGLHGERGPLQPMTREVLDT
FRALGAIQKRNGMRAARRYIISFAKSAQHVRDVFELNRLAFAHPQDAPTIDVIPLFEQLE
DLQNSVNVLEEIIKIPEVQARLKATGRKMEVMLGYSDSSKDAGPTSATLALHSAQERIAQ
WAKDHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVNCRFKLTEQGEVIFARYGNPIL
AIRHLESVAAATLLQSAPSVEKTNTEMTHKYADMAQKLDVAAHNRFIDLLQTDDFTPWFS
TVTPLSEIGLLPIGSRPAKRGLGAKSLDDLRTIPWVFSWAQARINLAAWYGLGTACEKFG
DLETLRRAYEEWPLFSTFIDNIEMSLAKTDERIARMYLSLGDREDLSDKVLSEMQLTRKW
VLQIVGDKWPLQHRHVLGQAIRVRSPYVDALSVIQSLALHKLRNKVDKEELSESQQAEFI
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaaaatcaacaggtgactccagcagacgcaacaatagttacgtctggacta
ggacgaaaaggacctgaagagcgcgaactgccagcatcgcttaagcaagacatggattta
tgcttacatattctgcgcgatgtattaggcgaatttgatgaaaaactattaacagtattc
gacgaagtgcgattaaacgcagtagacgcaagcgcagcacacttcgcacaaatggttgat
gcacaaggaacagaagacgacggactaaacaaagctgtagaaaaaatcaacggcatggat
ttgccagatatgcagcttcttgcgcgtgcgtttgctacatacttccacttagcaaacctg
tgcgaagaaaactacagggtctccgtgctgcaccaacgcgaatgcgaagtagaagaatct
aatcccgtagacccagttaacgagctaacatgcgcataccacaagttgctcacggaaatg
agccctgcgcaagctaaggaactgctaaataaacttgaattccatccagttttcacagcg
catccaaccgaagcaagacgaaaagctgtagctggtaaaatccgcagaatatcaaagctt
ctaagcaaacacaataggctaggaggatcagacaagcgcgaaaactacaggcgtctatac
aacgagatagacgcattgctccgcacatcgcctattgctcttaaaaaaccaacaccagtt
gaagaagcagacacgattctagatatttttgacgcaacattattcaacacaattccgttg
gtttatcgcagatttgacgattggcttttgggcaaaaaagctggattagtgccaccgcgc
tgcccagcattcttccacccaggaagttggattggatccgatagagacggaaatccaaac
gttacagcaaaggtaagtaggcaggttgcgagcaagtttagcaaccacgttttgaaagcg
ctggaagaacgcacgcgcgaagttggcaaatgcctgactatggaaacacgcacaacgcct
ccaagcgttgagctgctggaactttggaaccgccagagggaaatgagcgagcagctcact
gaaaacgcgtccgacgtatctaatagcgagccgcatagagccgttatgcttgtgatggca
gaccgactacaccacacgattagccgcaatacagacttgatgtatcattcttgcgaagag
ttcattgaagatttgcggatagtgcaacgttcgcttgctgaggctggagatgctcgagca
gcatatggaccattgcaggatttgatctggcaggcgcaaacctttggattccacatggtg
gaaatggagttccgtcagcattcgctcgtgcattcgcgcgctttggaagatattcgcgaa
catggtttgcacggggagcgtggaccgcttcagccaatgactcgcgaagttctagacaca
ttccgcgcgcttggagcaattcaaaagcgcaacggtatgcgtgcagctcgccgctacatt
atttcgtttgcaaagtctgctcagcatgttcgcgatgtatttgagcttaatcgccttgcg
tttgcgcatccacaggatgctccaacaattgacgtaataccactttttgagcagctagaa
gatttgcagaattcggttaatgttcttgaggaaatcattaagattccagaagttcaggct
agactgaaggctactggtcgcaagatggaagttatgctcggctactccgattcttccaaa
gacgcaggtcctacttctgcaacacttgcattacattctgctcaagaacgtattgcacag
tgggctaaagatcatgacattgatttgacactgttccacggtagaggaggagctgttgga
cgaggcggtggtcctgcaaaccgtgctgttcttgctcaaccagttggttcagtaaattgc
cgatttaagcttactgaacaaggtgaggttattttcgcccgctacggaaacccaattctt
gccattcgtcacttggaatcagtagctgcagcaactttgcttcaatctgctccaagcgtt
gagaaaaccaacacggaaatgacgcacaagtatgctgatatggctcaaaagcttgatgtt
gcagcgcataatcgttttattgatttgcttcaaacagatgactttacgccttggttctca
accgttactccgcttagtgagattggtttgctcccaatcggatctcgccctgcaaagcgc
ggtcttggtgcaaagtctttggacgatttgcgcacaattccatgggtgttctcttgggcg
caagctcgaatcaacttggcagcgtggtacggcttgggtacagcttgcgaaaagtttggc
gacttggaaactttgcgcagagcttacgaagaatggccgctgtttagtacttttattgac
aacattgagatgtctttggctaaaacagacgagcgaattgctcgcatgtatctaagcctt
ggagatcgcgaagatttaagcgataaagtgctttcggaaatgcaacttactcgcaagtgg
gttttgcaaattgttggagataaatggccgttgcaacatcgccatgtgcttggccaggcg
attcgcgtgcgctcgccttacgtggacgcgctttctgtaattcagtcacttgctttgcat
aagcttcgcaataaggtggataaggaagaattgagcgaaagccagcaggcagagttcatc
tacctgattctctgcactgtttccggtgttgctgcaggcttgcaaaacactggatga

DBGET integrated database retrieval system