KEGG   Gloeobacter violaceus: gll3143Help
Entry
gll3143           CDS       T00148                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
gvi  Gloeobacter violaceus
Brite
Enzymes [BR:gvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     gll3143
Peptidases [BR:gvi01002]
 Metallo Peptidases
  Family M2
   gll3143
Exosome [BR:gvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   gll3143
CD molecules [BR:gvi04090]
 Proteins
  gll3143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(3346388..3348283)
Genome map
AA seq 631 aa AA seqDB search
MVETVKRGASAVKRHFCLAGLLLSLGAHAVAAEPPPPRVATTKNIAEAQAFMQKAEGELA
ALGVQSNRASWVNATYITGDTEALAAEAQKNLAAATQRLAMAAKRFDNAPLPPELARKFK
LLKLSLAAPPPGDPNAQVELTKITVGMESEYGRGTYCRPGADGKETCLQINELSRILATS
RDPQELLDVWQGWHKIAVPLRPRYERFVQLANKGASELGFADTGAMWRSNYDMEPDAFAA
EVERLWGQVQPLYVSLHAYVRTKLGEQYGTKLVPANRPIPAHLLGNMWAQEWGNIYPLVA
PAGVVPSYDLTQLLKAKNVDERGMFGYGERFFTSLGFDSLPKTFWERSMLVKPKDREVVC
HASAWEIDNPDDIRIKMCTEVTGEDFVTVHHELGHNFYQRAYKKQPPLFRNSANDGFHEA
VGDTIALSVTPEYLVKVGLMGTIPGPEADTGILLRQALDKVAFLPFGLLIDQWRWKVYSG
AVQPKDYNKAWWALRERYQGVSAPLPRSEADFDPGAKFHVPANTPYTRYFLARVLQFQFH
RALCREAGYTGPLHRCSVYGNKAAGAKLALMLEAGQSRPWPEVLSAMTGERQMDATAMLD
YFAPLKSWLDEQNKGVKVGWESAGSVSSTIR
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaacggtcaaaagaggagcatctgctgtgaaacgccatttctgcctggccggg
ctgttgttgagcctgggtgcccatgccgtcgccgccgagccgcctcccccgcgcgtggcc
acgactaaaaatattgccgaggcgcaagccttcatgcaaaaagccgagggcgaattggcg
gcgctgggggtgcagtccaaccgggccagttgggtcaacgccacgtatatcaccggggac
accgaggcattggcggcggaagcccagaaaaatttggccgcggccacccagcggctggcc
atggctgcgaagcgtttcgacaacgcgcccctgccaccggaactggcgcgcaaattcaaa
ctgctcaagttgagcctggcggctccgcccccgggcgatcccaatgcacaggtcgaattg
accaagatcaccgtcggtatggagagcgagtacggccggggcacctactgccggccgggg
gcagacggcaaagaaacttgtctgcagatcaacgagctttcgcgcatcctcgccaccagc
cgcgatccgcaggaactgctcgatgtttggcagggctggcacaaaattgccgtgcccctg
cggccccgctacgagcgctttgtgcagttggcgaacaagggggcgagcgaactgggcttt
gccgataccggggcgatgtggcgctccaactacgacatggaaccggacgcctttgccgct
gaagtcgagcggctctgggggcaggtccagcctctgtacgtctcgctgcacgcctacgtg
cgcaccaagttgggcgagcagtacggcaccaaactggtaccggcgaatcgacccatcccc
gcccacctgctcggcaacatgtgggcacaggagtggggcaatatctatccgctagtcgcc
ccggcgggggtggttcccagttacgacctcacccagctgctcaaggccaaaaacgtcgat
gagcgaggcatgttcggatacggcgagcgctttttcacctcgctcggatttgattctctg
cccaaaactttttgggaacgttcgatgctcgtcaaacccaaagatcgcgaggtggtctgc
cacgcgagcgcctgggaaatcgacaatcccgacgatatccgcatcaagatgtgcaccgag
gtgacgggcgaggattttgtcactgtccaccacgaactgggccacaacttctaccagcgc
gcctacaaaaagcagccgccgctgtttcgaaacagcgccaacgacggctttcacgaggcg
gtgggcgacacgatcgccctctcggtgacaccggagtacctggtcaaagtcggactgatg
ggcaccatccccggtcccgaagccgacaccggcatcctgctgcggcaggcgctcgacaaa
gttgcctttttgcccttcgggctgctcatcgaccaatggcgctggaaagtctactcgggc
gccgtccagcccaaagactacaacaaagcctggtgggcactgcgcgagcgctaccagggc
gtctcggcccccctgccgcgctcggaggccgacttcgaccccggcgccaagttccacgta
ccggccaacaccccctacacccgctatttcctggcgcgggtgctgcagttccagttccac
cgggcgctgtgccgggaagcgggttataccggccccttgcaccgctgttcggtctacggc
aacaaagcggcgggggcgaagcttgcgttgatgctcgaagccgggcagagccgtccctgg
ccggaggtgctctccgcgatgaccggcgagcgacagatggacgcgaccgccatgctcgac
tactttgcacccctcaaatcctggctcgacgaacaaaacaaaggcgtcaaagtcggctgg
gagagcgccggatcggtcagttcgacaattcgatag

DBGET integrated database retrieval system