KEGG   Geobacillus sp. WCH70: GWCH70_2392Help
Entry
GWCH70_2392       CDS       T00915                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gwc  Geobacillus sp. WCH70
Brite
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GWCH70_2392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2431882..2432496)
Genome map
AA seq 204 aa AA seqDB search
MAFELPQLPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHADLQNKSIEELLSN
LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELADAINKKFGSFAAFKEEFT
KAAATRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRPE
YIAAFWNIVNWDEVARRYSEAKAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattaccgcaattgccttatgcttatgatgcgttagagccacacattgac
aaggaaacaatgaacattcaccacacaaaacaccataacacttatgtcacaaacttaaat
gccgctttagaaggacatgcggacttacaaaacaaatcgattgaggaactgctcagcaat
ttggaagcacttccagaaagcattcgcacagcagttcgcaataatggcggcggacatgct
aaccactctctattctggacgattctttcgccaaacggcggcggtgagccaacaggcgaa
ctagcagatgcgattaacaaaaaatttggcagctttgctgcgtttaaagaagaatttaca
aaagcagctgcgactcgcttcggttctggttgggcttggcttgttgtcaacaacggtgag
cttgaagtgacaagcactccaaaccaagactctccattaatggaaggaaaaacgccaatt
cttggtttagacgtttgggagcatgcatattacttaaaatatcaaaaccgtcgtccagaa
tacattgccgcattctggaacattgtcaactgggacgaagtagcaagacgctacagcgaa
gcaaaagcgaaataa

DBGET integrated database retrieval system