KEGG   Geobacillus sp. Y412MC52: GYMC52_3014Help
Entry
GYMC52_3014       CDS       T01399                                 

Definition
(GenBank) Protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
gya  Geobacillus sp. Y412MC52
Brite
Enzymes [BR:gya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     GYMC52_3014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3061214..3062032
Genome map
AA seq 272 aa AA seqDB search
MIRVLSPINFDVSSSFSLPASEQRILDALVSSPKLYTYANKHQLRFEIALRDRIVRAAGE
LAKSRARFAIFRFSRCNSDFWTRDERGGFRLRPDVTASEAIQDIFVHSERYAFECATAIV
IVFYKAVLDVIDPAAFNRLFADLLLYDWHTDRDLGIQTKKDEHFLPGDCLYFKNPEFDPL
TPQWQGENAIYLGDGFFYGHGIGIQTADGIIAALNRKRKRGATKSAYLLPDITQVDFAYL
SQFARGFDEFRLPIRRPPFIVGTLGSATFLLR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgcgtgttgtcgccaatcaactttgacgtttcgagttcgttttcgcttccggcc
agcgaacaacgaatcttagatgcccttgtttcctcgcctaagttgtatacgtatgcaaat
aaacaccagcttcgatttgaaatcgccttgcgcgaccgcattgttcgggcggcgggcgag
ttggcgaaaagccgggcgcggtttgccattttccgtttttcgcgctgcaacagcgatttc
tggacgcgggacgagcgcggcggcttccgtcttcgtccagatgtcacggcttccgaagcg
attcaggacatttttgtccatagcgagcgatacgcgtttgaatgcgcgaccgcgatcgtc
atcgtgttctacaaggccgtgcttgacgtaatcgatccagcggcattcaaccggctgttt
gcggatttgctgctgtatgactggcataccgaccgggatcttggcattcaaacaaaaaaa
gatgaacactttctccccggagattgcctctattttaaaaacccggaattcgatccgttg
acgccgcaatggcaaggggaaaatgccatttacttaggcgacggcttcttttacgggcat
ggcatcggcatccagacggcagacggcatcatcgccgcgctcaatcgaaaacgaaagcgg
ggggcgacgaaatccgcttacctgcttcccgatatcacgcaagtcgatttcgcttatctg
tcccaattcgcccgcggcttcgatgaattccgcctgccgatccgccgcccgccctttatc
gtcggaacgttagggtccgctacgttcttgctccgttag

DBGET integrated database retrieval system