KEGG   Geobacillus sp. Y412MC61: GYMC61_0782Help
Entry
GYMC61_0782       CDS       T01101                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00020  Citrate cycle (TCA cycle)
gyc00480  Glutathione metabolism
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01120  Microbial metabolism in diverse environments
gyc01130  Biosynthesis of antibiotics
gyc01200  Carbon metabolism
gyc01210  2-Oxocarboxylic acid metabolism
gyc01230  Biosynthesis of amino acids
Module
gyc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gyc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GYMC61_0782
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GYMC61_0782
Enzymes [BR:gyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GYMC61_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACX77451
JGI: GYMC61_0782
LinkDB All DBs
Position
775340..776611
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVQNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKLTGSWLPDETLETIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFPGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEQGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EEEFADKVFTWAQYDRIVETEGKEAANKALADAEASGKIIIKDVIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIKAMEKTIAAKIVTYDFARLMEGATEVKCSEFADALIR
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggagaaaaaattacagtccaaaatggtgtgctcaacgttccgaacaacccg
atcattccgttcatcgagggggatggaaccggcccggacatttgggcggccgcttcgcgc
gtgctcgaagcagcggtggaaaaagcgtacaaaggtgagaaaaaaatcgtttggaaggaa
gtgctcgctggtgaaaaagcgtacaagctgacgggcagctggcttccggatgaaacgctt
gagacgatccgcgaatacataatcgccattaaagggccgttgacgacgccggtcggcggc
ggcatccgctcgctgaacgtcgcgctccgccaagagctcgacctgtttgtctgcttgcgt
ccggttcgctacttcccaggcgttccgtcgccggtgaaacgcccggaagacaccgatatg
gtcattttccgggaaaacacggaagacatctacgctggcattgaatatgccaaaggcacg
ccggaagtgaaaaaagtcatcgactttttgcaaaatgaaatgggcgtgcgcaaaatccgc
ttcccggaaacgtccggcatcggcattaaaccgatttccgaacaagggacgaaacggctt
gtgcgcgcggcgatcaactacgcgatcgaacacggccgcaagtcggtgacgctcgttcat
aaagggaatattatgaaattcaccgaaggcgcgtttaaaaactggggttatgaactggcg
gaggaagaattcgccgacaaagtgttcacgtgggcgcaatacgaccgaatcgttgaaacg
gaaggcaaggaagcggcgaacaaagcgcttgctgatgcggaagcgtccggcaaaatcatt
atcaaagatgtcatcgccgacatcttcctgcaacaaattttgacgcgtccgcgcgaattt
gacgtcatcgcgacgatgaacttaaacggcgactacatttccgacgcgctggccgctcaa
gtcggcggcatcggcatcgcgccgggggcaaacatcaactacgaaaccggccacgcgatt
ttcgaagcgacgcacggcacggcgccgaaatacgcagggcttgacaaagtcaacccgtcg
tccgtcattctctcgggcgtcatgatgtttgagcatcttggttggaacgaagcagcgaaa
ttgatcatcaaagcgatggagaaaaccatcgccgcgaaaatcgtcacgtatgacttcgcc
cgcctgatggaaggggcgacggaagtgaaatgctccgaatttgctgatgcgctcatccgc
aatatggactaa

DBGET integrated database retrieval system