KEGG   Hipposideros armiger (great roundleaf bat): 109379867Help
Entry
109379867         CDS       T04661                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hai00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    109379867 (GPD2)
Enzymes [BR:hai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     109379867 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 EF-hand_8 FAD_oxidored GIDA Pyr_redox_2 EF-hand_5 HI0933_like NAD_binding_8 FAD_binding_3 Pyr_redox_3 Thi4 Pyr_redox SPARC_Ca_bdg EF-hand_10
Motif
Other DBs
NCBI-GeneID: 109379867
NCBI-ProteinID: XP_019492407
LinkDB All DBs
Position
Un
AA seq 727 aa AA seqDB search
MAFKKAVKGTILAGGGALATVLGLSQFAHYRRKQMSLAYVEAADFVSEPVNREPPSREAQ
ILTLQNTSEFDVLIIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNVAIALTAARYG
AATANYMEVVSLLKKTDPQTGKERVSGARCKDALTGQEFDVRAKCVINATGPFTDTLRKM
DDKNATAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPVPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTIDAAIKAHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELHWDEYKKKEELETAKKFLY
YEMGYKSRSEQLTDRSEISLLPSDVDRYKKRFHKFDADQKGFITTVDVQRVLESINVQID
ENTLHEMLNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaaaaaggcagtgaaagggactattcttgctggaggaggtgctcttgcaact
gttctaggcctctctcagtttgctcattacagaaggaagcaaatgagcctggcctatgtg
gaagcagcagactttgtttcagaacctgtcaacagggagcctccttccagagaagctcag
atactgactttgcaaaacacgtcagaatttgatgtccttatcattggaggaggagcaaca
ggatgcggctgtgcactagatgctgtcaccagaggactgaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccatggtggtgtgaga
tatcttcagaaggctatcatgaagttggatattgagcagtataggatggtaaaagaagcc
ctccacgaacgtgccaacctactagaaattgctccccatttatcagctccgttgcctata
atgcttccaatttacaagtggtggcagttaccttactactgggtaggaatcaagctgtat
gatctggtagccggaagtaattgcctgaaaagcagttatgtcctcagcaaatcaagagcc
ctcgaacacttcccaatgctgcagaaggacaaactggtgggagccattgtctactacgat
ggacagcacaacgacgctcggatgaatgttgccatcgcgctcactgctgccaggtacggg
gctgccacggccaattacatggaggtcgtgagcttgctgaagaagacagacccccagacg
ggaaaggagcgtgtgagcggcgcacggtgcaaggatgcgctcacagggcaggaatttgat
gtgagagcaaaatgtgttatcaatgccacgggaccttttacagacacgctccgcaaaatg
gatgataagaacgccacagctatctgccagccgagtgccggtgtgcacattgtgatgcct
ggttattacagcccagagagcatgggacttcttgacccagcgaccagtgatgggagagtt
attttcttcttaccctggcaaaagatgactatagctggcactaccgacactccaactgat
gtcacacaccaccctgttccttcagaagaagatatcaacttcattttgaatgaagtgcgt
aactacctgagttgtgatgttgaagtgagaagaggggacgtcctggcagcgtggagtggt
attcgtccccttgttaccgatcccaagtctgcagatactcagtccatctcccgaaatcat
gttgtggatatcagtgagagcggcctcatcactatagcaggtggaaagtggacaacctat
cgatctatggcagaagataccatagatgctgcaatcaaggctcataatttgaaagcagga
ccaagtagaacagttgggcttttccttcaagggggcaaagattggagccccacactctac
attaggcttgtccaggattacggacttgaaagtgaggtggctcagcatcttgctgcaacc
tacggtgacaaggcttttgaggtggccaaaatggcaagtgtgactggaaaaaggtggccc
attgttggtgtgcgtcttgtgtcagaatttccatacattgaagcagaggtgaaatacggg
attaaggagtatgcctgcactgcagtggatatgatttcacgtcgcactcgcctggccttt
ctcaatgttcaggccgcagaggaagccctacccaggatcgttgagctgatgggcagagaa
ctacattgggatgagtataaaaaaaaggaagaacttgaaacagccaagaagtttctatat
tatgaaatgggctacaaatctcgatcagaacagttaacagatcgctctgaaattagtcta
ctgccttcagacgttgacaggtacaagaagagatttcataagtttgatgcagaccaaaag
ggctttattaccactgttgatgttcagcgtgtattagagagtatcaatgtccaaatagat
gaaaatacactacatgagatgctgaatgaggtagatttgaacaaaaatggacaagttgaa
ctcaatgaatttttgcagctgatgagtgctattcaaaaaggaagggtgtctggcagccga
ctggcgatactaatgaaaacagcagaagagaacctggacagacgggttcccattcccgta
gaccgaagttgtggaggattgtga

DBGET integrated database retrieval system