KEGG   Halomonas sp. KO116: KO116_01191Help
Entry
KO116_01191       CDS       T03800                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
hak  Halomonas sp. KO116
Pathway
hak00500  Starch and sucrose metabolism
hak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hak00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KO116_01191
Enzymes [BR:hak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KO116_01191
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     KO116_01191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C HTH_6 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AJY49684
UniProt: A0A0D5LZT5
LinkDB All DBs
Position
complement(1264098..1267445)
Genome map
AA seq 1115 aa AA seqDB search
MMDASSETHAVEAMDFLDDPLWYKDAVIYQVHVKAFFDANDDGIGDFEGLIQKLDYIVSL
GVNTIWILPFYPSPRRDDGYDIAEYTSVSPDYGTLDDAKRFIQEAHQRGLRVITELVINH
TSDQHEWFQRARQAPAGSPERDFYVWSDTDQKYPGTRIIFLDTESSNWTWDPVAGAYFWH
RFYSHQPDLNFDNPVVLDEILKVMEYWLDMGVDGLRLDAIPYLVEREGTNNENLPETHVV
LKKIRAVLDERYPDRMLLAEANQWPEDTRPYFGDGDECHMAFHFPLMPRMYMALAQEDRF
PITDILRQTPEIPATCQWAIFLRNHDELTLEMVTDKERDYLWNHYAADRRARINLGIRRR
LAPLLERDRRRIELLNSLLLSMPGTPVLYYGDEIGMGDNIYLGDRDGVRTPMQWSVDRNG
GFSRADPAKLVLPPIMDPLYGYQTVNVEAQIRDSHSLLSNMRRLLAVRSQHRAFSRGTMR
PLYPSNRHILAYLREMTLDNGETETLLCVANVASTAQAVELDLSAFSGQVPVEMVGGSAF
PPVGKLAYLLTLPPYGFFWFLLAPATAMPEWHVPVPEPMPDFVTLIIKKRLNEIFEETPR
RLLERETLPSYLPKRRWFAAKQARIEEVHLHATASLEHSGHTLLFSEVEVKHGQGSERYQ
LPLAFLGEDEQSNPLPQQLAMARVRRFHEVGLLTDAVTLDAFTLAVLENMRLGTVLPYEK
GEIHFLPTATFAELTLPEHLEVVQQSAEQSNSSVIINHQLVLKLFRRLEPGIHPEAEIGS
YLTERGFTHTVPLYGVVTRLEEGATQTLMILQGFIDNQGDAWSWTRNKLERAIREAVADD
ERASEPKAEARYGAFEELAEFATTLGRRLGELHMVLATPNDDPAFTPEVAGLSHVQHWTQ
RVTQRVEEALNVLEQHKNTANEAEQRLADIILARRATLMDAIKKMSELAQGSLLTRIHGD
LHLGQVLVAHDDAYIIDFEGEPARPLEERRAKDSPLRDVAGMLRSFDYAYAKVEEARPGD
NEGADTHTGTSHAVVEQYLLKGRQAFLNAYWLATMEIPHEWKQASGAAAAVDLFVLEKTA
YEIAYEAANRPEWLGVPLHGLAALIEQLSPGEPHE
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgccagcagcgaaacacacgccgtcgaggcgatggatttcctcgatgaccca
ctctggtacaaagatgcggtgatttaccaggtacacgtgaaggccttcttcgatgccaac
gatgatggtatcggcgacttcgaagggcttatccaaaagctcgactatatcgtcagcctg
ggcgtcaacacgatttggattttgccgttctacccctcgccgcgtcgcgacgatggttac
gatattgctgaatacaccagcgttagccccgattacggcacgcttgatgacgccaagcgc
ttcatccaggaggcccaccagcgcggactgcgcgtgattaccgaactggtcatcaaccat
acgtctgaccaacacgagtggtttcaacgcgccagacaggcgccagcaggatcaccagag
cgcgacttctatgtatggtcggacaccgatcaaaagtaccccggcacacgcatcatcttt
ctggacaccgaatcctccaactggacctgggacccggtggccggcgcctacttctggcat
cgtttctactcccaccagccggatctcaacttcgataaccccgtggtactcgatgagatt
ctcaaggtcatggagtactggctcgatatgggggtcgatggcctgcgcctggacgccata
ccgtatctggtcgagcgcgaaggcaccaacaacgaaaacctgcccgaaacccatgtggta
ctcaagaagatccgcgcggtgctcgacgagcgctaccccgaccgcatgctgctcgccgag
gccaaccagtggcccgaggacacccggccctacttcggcgatggcgatgagtgccacatg
gcattccacttccctttaatgccgcgcatgtacatggctctcgcccaggaagaccgcttc
ccgattaccgatattttgcgccagaccccggaaataccggccacctgccagtgggcgatc
tttttgcgtaaccacgacgagctgacccttgaaatggtgaccgataaggagcgcgactac
ctctggaatcactacgccgccgaccgtcgggctcgtattaatttgggcattcgtcgtcgg
ttagcgccgctgcttgaacgcgaccggcggcgtattgagctgcttaacagcctgctgctc
tccatgccgggcacgccggtgctctattacggtgacgagattggtatgggtgacaatatc
tatctcggcgaccgtgacggcgtgcgcacgcccatgcagtggtcggtggatcgcaacggc
ggcttctcccgcgccgacccggccaagctcgtgctaccgccgatcatggatccgctctac
ggctatcaaacggtcaatgtcgaagcacaaattcgtgactcgcactcgctgcttagcaat
atgcggcggctactcgcagtacgcagccagcaccgtgctttcagccgtggcaccatgcgg
ccactctacccctccaatcggcatattctcgcctacctacgcgagatgacactcgataat
ggcgagacagaaacactgctgtgcgtggccaatgtggccagcactgcccaggcggtggag
ctcgatctttccgcgttttccggtcaggtgccggtagaaatggtcggcggaagcgctttt
ccaccggtgggtaaactggcgtacctgctgacgctgcctccttacggttttttctggttc
ttgctggccccggctaccgccatgccggagtggcatgtgcctgtaccagagcccatgccg
gatttcgttacgctgattatcaaaaagcgccttaacgagatttttgaggagacacccagg
cgactactcgaacgcgagacgctgcccagctacctgcccaagcgacgttggttcgccgcc
aagcaggcgcgtattgaggaagtccacttacacgccactgccagccttgagcacagcggc
catacgctgctgtttagcgaagtggaggtcaaacatggccaaggcagcgagcgctaccaa
ctgccgctggctttcctgggcgaagatgaacagagcaatccgctaccccaacagctcgcc
atggcccgtgttcgtcgcttccacgaagtggggctactcaccgatgcggtcaccctggat
gcctttacactggcggtactagaaaacatgcgcctaggcaccgtgctgccttatgagaaa
ggagaaattcatttcttgccaaccgccaccttcgccgaactgacacttcccgagcacctc
gaggtggtgcagcagagtgccgagcaatccaatagctcggtgatcatcaatcatcaatta
gtgctcaagctgttccgacgcttggagccaggcattcatcccgaagcggaaatcggcagt
tacctgactgagcggggctttacgcataccgtgcctttgtacggcgtggtcacccggctc
gaagagggagccacgcaaacgctcatgattctgcaaggcttcatcgacaaccagggcgat
gcctggtcatggacgcgcaataagctggaacgtgccattcgtgaagcggtggcggacgac
gaacgggcaagcgagccaaaagccgaagcccgctacggcgccttcgaggagttggcagag
tttgccactaccttagggcgtcgattgggtgagctgcatatggtgctggcgacgcccaac
gacgacccagcattcacgcccgaagtcgctggtctctcccatgtgcagcactggacacaa
cgcgtgacgcagcgtgttgaggaagcgctaaacgtgctggagcaacacaagaacactgcc
aacgaagccgaacagcggcttgccgacattattttggctcgccgcgccacgttgatggat
gccatcaaaaagatgtcggaacttgcccaaggcagcctactcacccgtattcatggtgat
ctacatcttggccaagttctggtggctcatgatgatgcttacatcatcgattttgaaggc
gaaccggccaggcccttggaagagcgtcgcgcgaaggatagcccgctgcgcgatgtggct
ggcatgttgcgctccttcgactacgcctatgccaaggtggaggaagcccggcccggcgac
aatgaaggcgctgatacgcataccggcaccagccatgcggtggtggagcagtatctgctt
aaaggtcgccaagcctttctcaacgcttattggctggccaccatggaaataccccacgaa
tggaagcaagccagcggagccgctgcggcggtggatctgttcgtgctggaaaagacggct
tacgaaatcgcctacgaagccgccaaccgccccgaatggttgggtgtgccgctgcacggc
ttagctgccctcatcgaacaacttagcccaggagagccacatgaataa

DBGET integrated database retrieval system