KEGG   Halomonas sp. 1513: BWR19_11720Help
Entry
BWR19_11720       CDS       T04761                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
halo  Halomonas sp. 1513
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:halo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BWR19_11720
  Energy metabolism
   00680 Methane metabolism
    BWR19_11720
Enzymes [BR:halo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BWR19_11720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2592593..2595241)
Genome map
AA seq 882 aa AA seqDB search
MSDDLHESLRDNVRVLGDSLGRTIADDQGSAFVDKIETIRGFAKRGRQGDQPSRRELIEF
LRKLPDRDLLPVTRAFNQFLNLANIAEQHYRARYRRVEDYKPGSQPVLGELLRRAEAEGH
APRKLVETLAGMRVELVLTAHPTEVIRRTLIQKYDAIDDCLSVIETAADYPEQSSRAHGR
LEELISQAWHTDEIRHERPTPVDEAKWGFAVIENSLWQAVPDFHRDLDSLLLETAGERLP
LDAAPLRFASWMGGDRDGNPNVTAKVTREVLLLGRWMAADLYLRDLEQLKAELSMWKANS
ALKAEVGDEAEPYRALLKRLSTRVEATRDWAKACLDGRSHEGGQIIETRDQLYSPLLACY
RSLCDVGLDTIANGTLLDTLRRVAVFGVTLTKLDVRQEASRHSQVFEELTDFLELGHYRE
WDEQQRQDFLLAELESRRPLIPRRWECSTETREVIDTFRVIAREQREALGTYIISMAAQP
SDVLAVALLMQEVGGDVRLPIAPLFETLDDLNRAGDVIDRLLALPGYRRLVGDSQEVMIG
YSDSAKDAGQLAAAWAQYRAQETLVEVCEEHAVDLTLFHGRGGTVGRGGGPAHAAILSQP
PGSVNGSLRVTEQGEMIRFKFGQPEIALRSMEIYACAVLEATLLPPPAPKPQWREEMDRL
AEIAHRGYVGVVREDPDFVPYFRAVTPEGALGRLPLGSRPTKRRQDGGVETLRAIPWIFA
WTQTRLMLPAWLGSGDAFITRLEEEGGLERLREMRREWPFFGTYLDMLEMLLAKGDVEIT
AYYERRLVDEPALLALGMNLRERFTRLQGVLLEILDQQALLENTPLIRQAIEVRNPYIDP
LHGLQAELLQRNRDADGAISPELSRALMVTMAGIAAGLRNTG
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgatctccacgaatcgctgcgtgacaacgtgcgtgtgctgggcgacagcctg
gggcgcaccattgccgacgaccagggcagcgccttcgtcgacaagatcgagaccatccgc
ggcttcgccaagcgcggccgccagggcgaccagcccagccgccgcgagctgatcgagttc
ctgcgcaagctgcccgaccgcgacctgctgccggtgacccgcgccttcaaccagtttctc
aacctggccaatatcgccgagcagcactaccgcgcccgctaccgccgggtcgaggactac
aagccgggctcgcagccggtgctcggcgaattgctgcgccgcgccgaggccgaagggcac
gcgccgcgcaagctggtcgagaccctggccggaatgcgcgtcgagctggtgctcaccgcc
catcccaccgaggtcatacggcgcaccctgatccagaagtacgacgccatcgacgactgc
ctgtcggtgatcgagacggcggcagactatcccgagcagtcgagccgcgcccacggccgc
ctcgaggagctgatcagccaggcctggcataccgacgagattcgccacgagcgtcccacc
ccggtggacgaggccaagtggggctttgcggtgatcgagaactcgctgtggcaggcggtg
cccgacttccatcgcgacctcgatagcctgctgctggaaaccgccggcgaacgcttgccg
ctagacgccgcgccgctgcgcttcgcctcgtggatgggcggcgaccgcgacggcaatccc
aatgtgacggccaaggtcacccgcgaggtgctgctgctgggccgctggatggccgccgat
ctgtatctccgcgacctcgagcagctcaaggccgagctgtcgatgtggaaggccaacagt
gcgctcaaggccgaggtgggtgacgaggccgagccctatcgggcactgctcaagcgccta
tccacgcgggtcgaggcgacccgcgactgggccaaggcgtgcctcgacgggcgcagccat
gagggcgggcagatcatcgagacccgtgaccagctctattcaccgctgctggcctgctac
cgctcgctatgcgacgtcgggctcgacaccatcgccaacggcaccctgctggataccctg
cgccgggtggcggtgttcggcgtcaccctgaccaagctcgacgtgcgtcaggaggcgagt
cgccacagccaggtcttcgaggagctcaccgacttcctcgaactgggccactaccgcgag
tgggacgagcagcagcgccaggatttcctgctcgctgaactcgaatcccgccgcccgctg
atcccgcgccgctgggagtgctccaccgagacccgcgaggtgatcgacaccttccgggtc
atcgcccgggagcagcgcgaggcgctgggcacctacatcatctcgatggcggcgcagccc
tccgacgtgctggccgtggcgctgctgatgcaggaggtcggcggcgacgtgcggctgccc
atcgcgccgctgttcgagaccctcgatgacctcaaccgtgccggcgacgtgatcgaccgg
ctgctggcgctgcccggctatcgacgcctggtgggggatagccaggaggtgatgatcggc
tactccgactcggccaaggacgccggccagctggccgccgcctgggcccagtatcgcgcc
caggagaccctggtcgaggtctgcgaggagcacgccgtggacctgacgctgttccacggc
cgcggcggcaccgtcggccgcggcggcggcccggcccatgcggcgatcctctcccagccg
ccgggttcggtgaacggcagcctgcgggtcaccgagcagggcgagatgattcgcttcaag
ttcggtcagccggagatcgcgctgcgttcgatggagatctacgcctgcgcggtgctcgag
gcgaccctgctgccgccaccggcgcccaagccgcagtggcgcgaggagatggaccgcctg
gccgagatcgctcaccgcggctacgtcggggtggtgcgcgaggatcccgacttcgtgccc
tatttccgcgcggtgacgccggagggcgcgctggggcggctgccgctcggctcacggccc
accaagcggcgccaggacggcggcgtcgagacgctgcgtgcgattccgtggatcttcgcc
tggacccagacccgcctgatgctgccggcctggctgggcagcggcgatgccttcattacc
cggctggaagaggagggcggcctcgagcggctgcgcgagatgcgtcgcgaatggccgttc
ttcggtacctacctcgacatgctcgagatgctgctggccaagggcgacgtcgagatcacc
gcctactacgagcggcgcctggtcgacgagccggcgctgctggcgctgggcatgaacctg
cgcgagcgtttcacccggctgcagggcgtgctgctggagatcctcgaccagcaggcgctg
ctcgagaacaccccgctgatccgtcaggcgatcgaggtgcgcaacccctatatcgacccg
ctgcacggcctgcaggccgaactgctgcagcgtaaccgcgacgccgacggggcgatcagc
cccgagttgtcgcgggcgctgatggtgaccatggcggggatcgccgccggactgcgcaat
accggctag

DBGET integrated database retrieval system