KEGG   Halomonas sp. R57-5: HALO0252Help
Entry
HALO0252          CDS       T04029                                 

Definition
(GenBank) Glutathione S-transferase ERD13
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ham  Halomonas sp. R57-5
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ham00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HALO0252
Enzymes [BR:ham01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HALO0252
Transporters [BR:ham02000]
 Other Transporters
  Pores ion channels [TC:1]
   HALO0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(255120..255743)
Genome map
AA seq 207 aa AA seqDB search
MITLYTFPQSRSLRAAWTLEELGLEYQCQHVALDTGEGQTAAHLARHPDGKVPVLEDGAL
TLFESAPICRYLAEQYGDGTLLPSDPAARAQVDQWLSFIVTEVEQPLWNQAKHKFALPAD
KRVPAVLPVCAWEFQRALSALERRYNGQETLVGNTFTLVDLFLTHTLSWAIGMKHRLPEP
LMAYRARHIQRAAMAKAMEKEQAAAKG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgctgtacactttcccccaatcccgatcgctgcgagcggcatggacgcttgaa
gagttaggcctagagtatcagtgccagcatgtggcgctggatacaggcgaggggcaaaca
gccgcgcatttggcgcgtcacccggatggcaaggtgccagttcttgaagatggagcacta
acgctatttgagtcggcgccgatttgccgttacctagcggagcagtacggtgatggcacg
ttactccccagcgaccctgccgcccgcgctcaggttgaccagtggctcagctttatcgtc
accgaagttgaacagccgttatggaaccaggccaagcataaatttgccctacctgcagat
aagcgcgttcccgctgtgctaccggtttgtgcctgggagtttcagcgtgcgttaagtgcc
ctggagcgccgctataacggtcaagaaaccttggtggggaatacctttactctcgtggat
ctgtttttaacccataccttgtcttgggcgattggcatgaagcaccgcttacccgaaccg
ctgatggcctatcgcgcacgccatattcagcgtgccgcgatggcaaaggcaatggaaaaa
gagcaggcggcagcgaagggctaa

DBGET integrated database retrieval system