KEGG   Herpetosiphon aurantiacus: Haur_4237Help
Entry
Haur_4237         CDS       T00614                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Haur_4237
  Energy metabolism
   00680 Methane metabolism
    Haur_4237
Enzymes [BR:hau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Haur_4237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
5400885..5403674
Genome map
AA seq 929 aa AA seqDB search
MYTPETDRTPLSMLIHSLGNVLGDVIVAQDGVSAFELEEDVRQRTKQRRSDGTLQETQTL
TELISQLPVAQLMGLIKAFTHYFGLVNLAESVERLRVLAERDRQNGDAPRSESVELALQE
LRDRGITAQQVQDLLDHAEIRPVFTAHPTEAKRRTTLKKHHRIAGAARQLTADTTFQRQR
ERLLESIREEVISLWQSDEVRIIKPTVIDEVKNNLYYFEESLFDMIPQLYRDTEASLRQI
YPEHEWRVPAFLRFGSWVGGDRDGNPFVIPSVTVETLKLLMGRSLREHIHSVERLSHRLS
QSSRQVPISEELAQSLIHDAPLFPELAQVLERRNPHEPYRQKCSYIHAKLHATLAYVERY
EPDWARGGHRPAEGTWYANANQYLADLATMEYSLRTNGAASVADGFLRDIQCSAKVFGLH
TATLDIRQHSSRHTNALSEIFEYAGICDDYASLSQAERTAVLERELANNRPLIPTHLYYS
PETVEIIETFRTIRAVLSDLNAEAIETYIISMTEGPSDILAVLLLAREAGIYQPGEHSWL
NIVPLFETGADLIAAPEIMHTLLSSEAYRQHLVLRNDVQEIMLGYSDSNKDGGFADAHWA
LYLAQVALAETCFRHRVAMRLFHGRGGAVGRGGGPANRAILGQPPGTVGGRIKITEQGEV
ISDRYAEPETAYRHQEQIINAVLRSSLGVSIAHISQEWHDAMSSLAKVSRKVYRGLVYDH
PHFLEYFRNATPITEISRLNIGSRPASRKASDRIEDLRAIPWVFSWMQSRHTLPGWYGLG
SALEHLIQADANGLTTLQGMYNDWPFFRTMLDNAQMILSKADMDIAAQYALLVPDQALAN
EIFGLIKAEYTRTVKWICEVAQINELLDTSPILQHSIKQRNPYVDPLSFVQIELLRRLRT
DPDGLEHSDLEDAILLSINGIAAGLKNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgtatacacctgaaaccgaccgcacgccgctttcaatgctgatccattccctcgggaat
gtgcttggcgatgtgattgtggcccaagatggggtgtcagcgtttgagcttgaagaagat
gtgcgccaacgcaccaagcaacgccgaagcgatggaacattgcaagagactcaaaccctg
actgagttgattagtcaattgccagttgcccaactcatggggctgattaaggcctttact
cattattttggcttggtcaatttggccgaaagcgttgagcgcctacgagtgctggccgaa
cgcgaccgccaaaatggcgatgcaccacgctctgaatcggtcgaattggcattgcaagag
ttgcgtgatcgtggcattaccgcccagcaagtgcaagatttgcttgatcatgccgagatt
cggccagtttttactgcccacccgaccgaggccaaacgccgaacgacgctcaaaaagcac
catcgcattgcaggggcggcgcggcaattaaccgccgatacgacctttcaacgccagcgc
gaacgcttgctcgaatcaattcgtgaggaagtgatctcgctctggcaaagcgatgaggtg
cggattatcaagccaaccgtgatcgacgaagtgaagaataatctctattacttcgaagaa
tcgctgttcgatatgattccgcaactctaccgtgataccgaggcctcgttgcgccaaatt
taccctgagcacgaatggcgtgtgccagccttcctgcgctttggctcatgggttggcggc
gatcgcgatggcaatccctttgtaattccctcggtcacggttgaaacgcttaaactgttg
atgggccgttcgttgcgtgagcatattcattcagttgagcgcttgagtcatcgtttaagc
caatcgtcgcgccaagtaccaattagcgaagaattagcccaatcgctaatccatgatgcg
ccgttgttccccgaattggcccaagtgctggagcggcgcaatccgcatgagccatatcgc
caaaaatgctcctacattcacgccaaattgcatgccaccttggcctatgttgagcgctac
gagccagattgggcacgcggcggccatcgcccagctgaaggcacctggtatgccaatgcc
aaccaatatctcgccgatttagcaaccatggaatatagcttgcgcaccaatggcgcggcc
tcagtcgccgatggctttttgcgcgatatccaatgctcggccaaagtctttggtttgcac
accgccaccctcgatattcgccaacacagcagccgccacaccaacgccctgagcgaaatt
tttgaatatgcaggcatctgcgacgattacgccagcctgagccaagccgaacgcacggct
gtattggaacgcgagctagccaataatcgtccgttgattccaactcatctctactacagc
cccgaaaccgttgagattatcgaaaccttccgcacaattcgcgcagtgctttccgattta
aatgctgaggccatcgaaacttacatcatttcgatgaccgaaggcccaagcgatattttg
gcggtgctgttgctggctcgcgaggcgggcatttatcagccaggtgagcatagttggctg
aatattgtgccattatttgaaaccggagccgacctcatcgccgcgccggagataatgcac
acgctgctttcgagcgaagcctatcgccaacatttggtgttgcgcaacgatgtgcaagaa
attatgttgggctacagcgattccaacaaagatggtggttttgccgatgcgcactgggcg
ctctatctcgctcaagtggccttggccgaaacctgtttccgacatcgagtggccatgcgg
ctgttccatggccgtggtggggcggttggccgtggtggcgggcctgccaaccgtgcgatt
ttgggtcaaccaccaggcacagtcggtgggcggatcaaaatcactgaacaaggcgaagtg
attagcgatcgttatgccgagccagaaacggcctatcgccatcaagagcaaattatcaac
gcagtattgcgctcatcgttaggcgtgagcatcgcgcatatcagccaagaatggcacgac
gcgatgagtagtttggccaaggtttcgcgtaaagtctatcgcggcttggtctacgatcat
ccgcacttcttggaatacttccgcaatgctacgccgattaccgaaattagccgcttgaac
attggctcacgcccagccagccgcaaagccagtgaccggatcgaagatttgcgagcgatt
ccctgggtttttagttggatgcaaagtcggcataccttgccaggttggtatggcttgggc
agtgccttggagcatttaatccaagctgatgccaatggcttgaccaccttgcagggaatg
tacaacgattggccatttttccgcaccatgctggataatgcccaaatgattttatccaag
gctgatatggatattgcggcgcaatatgccctgcttgtgcccgaccaagccttagccaac
gaaatctttggcctgatcaaagctgaatacacccgcaccgttaaatggatttgcgaggtg
gcgcaaattaatgagctgctggatactagcccaattttgcagcactcaattaagcagcgc
aacccgtatgttgacccattaagtttcgtacaaatcgaattgctccggcgtttgcgcacc
gatcccgatggacttgagcatagcgatcttgaagatgcaattttgttaagtatcaacggg
attgccgcaggcttgaaaaatacgggttag

DBGET integrated database retrieval system