KEGG   Hirschia baltica: Hbal_0598Help
Entry
Hbal_0598         CDS       T00945                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hba  Hirschia baltica
Brite
Enzymes [BR:hba01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Hbal_0598
Peptidases [BR:hba01002]
 Metallo Peptidases
  Family M2
   Hbal_0598
Exosome [BR:hba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hbal_0598
CD molecules [BR:hba04090]
 Proteins
  Hbal_0598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(633380..635233)
Genome map
AA seq 617 aa AA seqDB search
MKKILLGSAALLVAACASSQMPWQKTEAVAEAPAASVAAPVLTVEDAETFITAAEAELTE
MGEYAARVYWLQATNINFDTNWLVSKVGAKYTQMAVRLANGTKKYEDLDLPDELARKMSI
LKAGITIPAPSTDGVADELANITTNLESTYSTGTFEHNGEKLNLTQLSNIIAESRDPEEL
ATVWAGWREISKPMKSEYARMVEIANEGARELGFSDTADMWLANYDMPSADMEKEVERLW
TQVEPLYDQLHCKVRADLNEKYGDDVQPADGFIRADLLGNMWAQQWSNIYDIVGPETSGP
SYDVTTKLEEKGYTPLKMVETAENFFTSLGLEELPETFWERSQITRPRDREVVCHASAWD
LDSKDDIRIKMCTQVNAEDFQTVHHELGHNYYQRAYKNQSTLHQGGAHDGFHEAIGDFLA
LSITPSYLKDIGLIEESEIPDASADTGLLMNQALDKIAFLPFGLMVDKWRWEVFRGETTP
EEYNDSWVKLRQQYQGITPPVERASDAFDPGAKYHIPGNTPYLRYFLSFVMQFQFHKAAC
EMSGWEGPLHRCSIYNNKEVGEKFNAMMEMGASKPWPDALEAFTGTREMDGSAIIEYFDP
LMTYLKEENEGRACGWK
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattcttcttggaagtgcagcattattagtcgcagcttgcgcgtcttcgcaa
atgccttggcaaaaaacagaagcggttgccgaagcaccagcagcaagtgtggcagcgcct
gttttaactgtcgaagatgcagaaacatttatcacagccgcagaagcagagcttactgaa
atgggtgaatatgctgcccgcgtttactggctacaagccactaacatcaatttcgatacc
aattggctcgtttccaaagttggcgcaaaatacactcaaatggcagtgcgcctcgcgaac
ggcacaaagaaatacgaggatctggatttacctgacgagctagcgcgcaaaatgtccatc
ttgaaagctggcatcacgatcccagcaccttcaaccgatggtgtcgctgatgagcttgcc
aacattacaacaaatctcgaaagtacatactctacaggcacttttgaacataatggtgaa
aaactaaacctaacacagctttcaaacatcatcgctgaaagtcgcgacccagaagaactc
gcaactgtatgggccggatggcgcgaaatttctaaacccatgaaaagtgaatatgcacgc
atggtagaaattgccaatgagggtgcgcgtgaacttggcttcagcgacacagctgacatg
tggctggcaaattatgatatgccttccgccgatatggaaaaagaagttgagcgcctctgg
acgcaagttgagccactttatgaccaactccactgtaaagttcgagctgatctgaatgaa
aaatacggtgatgacgttcaaccagcagacggtttcatccgtgcagacctgcttgggaat
atgtgggcacagcaatggtcaaacatttatgatatcgttggtcctgaaacatctggtcct
tcctacgatgtgacaacaaaactagaagaaaaaggctacacgccattaaaaatggtcgaa
actgccgaaaacttcttcacatcccttggcctagaagaacttccagaaactttctgggaa
cgctcacaaatcactcgcccacgcgatcgcgaagttgtgtgtcatgcttcagcatgggat
cttgatagcaaagacgatatccgcataaaaatgtgtacacaggtgaatgctgaagatttc
caaactgtgcaccacgagctaggccacaattattaccaacgtgcctataaaaaccaatca
acccttcaccaaggaggtgcgcacgacggtttccatgaagcaattggtgatttcctcgca
ctttccatcacgccgtcttatctaaaagatatcggcctgattgaagagagtgaaattccc
gacgcttcagccgacaccggtttgttgatgaaccaagcgctagataaaatcgcattcctg
cccttcggattgatggttgataaatggcgctgggaagttttccggggcgagacaacacca
gaagaatacaatgattcatgggtaaaattgcgccagcaataccaaggcataaccccgcca
gtagagcgtgcatctgacgcattcgatcctggtgcgaaataccacattccaggcaacacg
ccatatttgcgttatttcctctcatttgtgatgcagttccaattccacaaagctgcttgt
gaaatgtctggatgggaaggcccgcttcaccgttgttcaatctataacaacaaagaagtg
ggtgaaaaattcaatgcaatgatggaaatgggtgcatccaaaccttggccagatgcgctt
gaagccttcaccggcacacgcgaaatggatggttctgccatcatcgaatatttcgatcca
ttgatgacatatctgaaagaagaaaacgaaggccgcgcttgcggttggaaataa

DBGET integrated database retrieval system